SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000012460 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000012460
Domain Number 1 Region: 393-624
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.13e-29
Family RecA protein-like (ATPase-domain) 0.0074
Further Details:      
 
Domain Number 2 Region: 245-334
Classification Level Classification E-value
Superfamily DNA primase core 0.0000199
Family Primase fragment of primase-helicase protein 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000012460   Gene: ENSMLUG00000013687   Transcript: ENSMLUT00000013690
Sequence length 682
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430148:802753:806315:1 gene:ENSMLUG00000013687 transcript:ENSMLUT00000013690 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWVLLRSVYPLRILLSLRGKWMGWRGLPRSLVPGPPRRRYRKEALPALDVPVLPVTATEI
RQYLRAHGIPFQDGHSCLRAPSPFLGASQLKDQTGATTSFSLYINKTTGRFLCMTSLAEG
SWEDFQASVEGRGDGDREGILLSEAPGAEDSEEIRRIWDRAVPLWELPEQEEAQLARAMF
GLTKVTDDTLKHFSVRYLRPARSLVFPWFSPGGLGLRGLKLLGAEGQGDGVHYVETTIPR
PGAYHNLFGLPLISRRDVEVVLTSRELDCLALNQSTGLPTLALPRGTTCLPPDLLPYLEQ
FRRIVLWLGDDLRSWEAAKLFARKLNPKRCSLVRPGDQHPRPLEALNRGLNLPRILRSAL
PAWHKSIVSFRQLREEVLGELSNVEQVAGVRWSRFPDLNRLLKGHRKGELTVFTGPTGSG
KTTFISEYALDLCTQGVNTLWGSFEISNVRLARIMLTQFALGRLEEQLDKYDEWADRFED
LPLYFMTFHGQQNIRTVIDTMQHAVYVYDICHVVIDNLQFMMGHEQLSTDRIAAQDYIVG
AFRKFATDSNCHVTLVIHPRKEDDDKELQTASIFGSAKASQEADNVLILQDRKLVTGPGK
RYLQLSKNRFDGDVGVFPLEFNKSSLTFSIPPKSKARLKKIKDDNGLVAKKSSSGKKGAV
PRNSETFSGEAPNQPDPSQLSR
Download sequence
Identical sequences G1PNE5
XP_006101794.1.53796 ENSMLUP00000012460 ENSMLUP00000012460

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]