SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000012464 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMLUP00000012464
Domain Number - Region: 123-173
Classification Level Classification E-value
Superfamily Cgl1923-like 0.00811
Family Cgl1923-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000012464   Gene: ENSMLUG00000013692   Transcript: ENSMLUT00000013694
Sequence length 265
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429918:1368687:1371315:-1 gene:ENSMLUG00000013692 transcript:ENSMLUT00000013694 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAAVFFGCTFVAFGPAFALFLITVAGDPLRVIILVAGAFFWLVSLLLASVVWFILVHVT
DPSDARLQYGLLIFGAAVSVLLQEMFRFAYYKLLKKADEGLASLSEDGRSPISIRQMAYV
SGLSFGIISGVFSVINILADALGPGVVGIHGDSPYYFLTSAFLTAAIILLHTFWGVVFFD
ACERRRYWTLGLVVGSHLLTSGLTFLNPWYEASLLPIYAVTVSMGLWAFITAGGSLRSIQ
RSFSCRRQEDSQVMVYSALRIPPED
Download sequence
Identical sequences G1PNE9
XP_005867456.1.60319 XP_006095254.1.53796 ENSMLUP00000012464 ENSMLUP00000012464

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]