SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000012732 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000012732
Domain Number 1 Region: 42-206
Classification Level Classification E-value
Superfamily EF-hand 2.78e-46
Family Penta-EF-hand proteins 0.0000001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000012732   Gene: ENSMLUG00000013991   Transcript: ENSMLUT00000013993
Sequence length 207
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430024:842320:853884:-1 gene:ENSMLUG00000013991 transcript:ENSMLUT00000013993 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAYPGHPGHPRASRAPRAGGGYYRVGYGGAPGGPTFPGQTQDPLYGYFAAVAGQDGQIDA
DELQKCLTESGIAGGYKPFNLETCRLMVSMLDRDLSGTMGFSEFKELWSVLNGWRQHFTS
FDSDRSGTVDPQELQKALTTMGFRLSPQAVNSIAKRYSTNGKITFDDYIACCVKLRALTD
NFRRRDTSQQGVVNFPYDDFIQCVMSI
Download sequence
Identical sequences G1PP25
ENSMLUP00000012732 ENSMLUP00000012732

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]