SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000012982 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000012982
Domain Number 1 Region: 152-373
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.57e-49
Family DBL homology domain (DH-domain) 0.00021
Further Details:      
 
Domain Number 2 Region: 376-507
Classification Level Classification E-value
Superfamily PH domain-like 1.67e-22
Family Pleckstrin-homology domain (PH domain) 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000012982   Gene: ENSMLUG00000014270   Transcript: ENSMLUT00000014273
Sequence length 788
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429777:7850422:7868388:1 gene:ENSMLUG00000014270 transcript:ENSMLUT00000014273 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPFGPPDERPLRGLVESRIETYGGQHRASAQSTGSNLYARRGLQLDPGRLRLQDYVPFA
KSSGQTRILSPMRFREPEPEKRLGSPFGAGPPHSPKLKEVTKAHELEMRLYTFSMFGMPR
LPPEDRRHWEIGKGSDSDLTIEKSWKELVPGHKEMSRELCHQQEALWELLTTELTYIRML
KIMTDLLAAGLLNLQRVGLLIEVSAETLFGNVPSLIRAHRSFWEEVLGPTLGKTRASGQP
LDPVSLQDGFLAVSQRFQPYVQYCLRVKQTMAYAREQQDNNPLFRTFVQWCEKHKRSGRQ
MLGDLLIKPHQRITKYPLLLQAVLKRTPEAQARQALNDMITAVESFLQHINKQVRQGEDQ
ENLVAAAQRIGPYEVLEPSSEEMEKNLRPFSNLDLMSPMLGVAPEHTRQLLLEGPARVKE
GREGKMDVYLFLFSDVLLVTKPQRRADKAKVIRPPFMLEKLVCRPLRDPNSFLAIHLTDF
QCVSSALIVHCPSTADRAQWLEKTQQAQVTLQKLKAQEYVQQKRELLALYRDQDQESLST
RPSTPSPEGSQSSVEGRNSEFCTVIPHLVVTDDTDEDIPSVPDDTSDSGYSTLIPVSPKE
SHTPLSRLRPWALRRHPGFTLSALDLRDVTLRPQPPDPQALQRRSTPELPGEVIRRGSSL
PRGERPAWSEEEDGTSVGGNVVMETLHRAQLRGQLPHSPTHADSAGESPWASSEDEEEEG
PLFRRPSPGPLSAEDMLREIREELASQRIEGSPEPGDSGPRKLTRVQLQRMRGPHIIRLD
TPLSTSEV
Download sequence
Identical sequences G1PPN3
ENSMLUP00000012982 ENSMLUP00000012982

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]