SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000012992 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMLUP00000012992
Domain Number - Region: 22-79
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.0981
Family DBL homology domain (DH-domain) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000012992   Gene: ENSMLUG00000014279   Transcript: ENSMLUT00000014283
Sequence length 166
Comment pep:novel scaffold:Myoluc2.0:GL430216:311135:315816:1 gene:ENSMLUG00000014279 transcript:ENSMLUT00000014283 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVLILACLVAFAFAKEKEQISVSRETIESISSSEESITHINKQKLENLENYYQQQKEDE
RQDKTHPFVQPQPLFYPYAEPMPYPVLPQNILPLAQPAMVLPLLQPEVMEIPNTKETIIP
KRNVMQLPKSPVVPFLQRQIPNLTDLKAQLPLPLLQPWMPQIPQPL
Download sequence
Identical sequences G1PPP3
ENSMLUP00000012992 ENSMLUP00000012992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]