SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000013292 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000013292
Domain Number 1 Region: 90-177
Classification Level Classification E-value
Superfamily SAND domain-like 5.58e-30
Family SAND domain 0.0000099
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000013292
Domain Number - Region: 249-345
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0144
Family Spectrin repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000013292   Gene: ENSMLUG00000014606   Transcript: ENSMLUT00000014607
Sequence length 537
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430322:75236:88679:-1 gene:ENSMLUG00000014606 transcript:ENSMLUT00000014607 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATPDVSVHMEEVVVVTTPDTAVDGNGMEEVKTVLVTTNLAAHGGDLSEDNMETENAAAA
AAAAFTASSQLKEAVLEVKMNEEGENLEAEILYPITCGDSRANLIWRKFVCPGINVKCVQ
YDEHVISPKEFVHLAGKSTLKDWKRAIRMNGIMLRKIMDSGELDFYQHDKVCSNTCRSTK
IDLSGARVSLSSPTSAEYLPLTPATADVNGSPATITIETCEDSGDWTTTIGDDTFAFWRG
LKDAGLLEEVIQEFHQEMVETMKGLQQRVQDPPLQLQDAVLLNNIVQNFGMLDLVKKVLA
SHKCQMDRSREQYARDLAALEQQCDEHRRRAKELKHKSQHLSNVLMTLTPVSLPPPIKRP
RLARATSGPAAIASQVLTQSAQIALSPGVPVSQLTSVPIGKVMSTLPSPVLGKGCPQAAS
TSSPASPLLGGYTVLASSGTSFPGTVEIHPDASSLTVLSTAAMQDGSTVVKVVSPLQLLT
LPGLGPALQNVAQVSPGGSTIVTVPTGAVESTMAAPGPEEHTATIEVAAMAEGHEHK
Download sequence
Identical sequences G1PQE8
XP_014302090.1.53796 XP_014302091.1.53796 XP_014302092.1.53796 ENSMLUP00000013292 ENSMLUP00000013292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]