SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000013320 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000013320
Domain Number 1 Region: 29-140
Classification Level Classification E-value
Superfamily SH2 domain 4.15e-32
Family SH2 domain 0.0000314
Further Details:      
 
Domain Number 2 Region: 153-215
Classification Level Classification E-value
Superfamily SH3-domain 1.44e-22
Family SH3-domain 0.00034
Further Details:      
 
Domain Number 3 Region: 4-41
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000372
Family SH3-domain 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000013320   Gene: ENSMLUG00000014638   Transcript: ENSMLUT00000014640
Sequence length 217
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430814:78753:103653:-1 gene:ENSMLUG00000014638 transcript:ENSMLUT00000014640 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESVALYSFQATESDELAFNKGDTLKILNMEDDQNWYKAELRGAEGFIPKNYIRVKPHPW
YSGRISRQLAEEILMKRNYLGAFLIRESESSPGEFSISVNYGDQVQHFKVLREASGKYFL
WEEKFNSLNELVDFYRTTTIAKKRQVFLRDEEPPLQPPRTGFAQAQFDFSAQDPSQLSFR
RGDIIEVLEHLDPHWWRGRFCGQVGFFPRSYVQPVHL
Download sequence
Identical sequences G1PQG8
ENSMLUP00000013320 ENSMLUP00000013320 XP_006107243.1.53796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]