SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000013414 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMLUP00000013414
Domain Number - Region: 148-248
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00935
Family Spectrin repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000013414   Gene: ENSMLUG00000014745   Transcript: ENSMLUT00000014743
Sequence length 515
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429879:1786802:1849240:1 gene:ENSMLUG00000014745 transcript:ENSMLUT00000014743 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CVGITEVVYILVKYVNQNSKYLVCKRKLESKKEALLILSKELDTCQQERDQYKLMANQLR
ERHQSLKKKYRELIDGDPSLPPEKRKQANLVQLLRDSQDRNKHLGEEIKELQQRLGEVQG
DNKLLRMTIAKQRLGDEEIGVRHFAAHEREDLVQQLERAKEQIESLEHDLQASVDELQDV
KEERSSYQDKVERLNQELNHILGGHENRIIDVDALCMENRYLQERLKQLHEEVNLLKSNI
AKYKNALERRKNTKGQGRSSSSALTGVLSAKQVQDLLSEDHGCSLPATPQSISDLKSLAT
ALLETIHEKNMVIQHQRQTNKILGNRVAELEKKLRTLEVSGLWSLPGGKDTIMLNDPTLP
TTQRSRSPLLKFAEQPTEDKANPKSGEVQTQDGDESCAAAEVLTAPEDAGRPAVNSPADE
SQGHRRKHFHPSLPSLPSAEEEVNRPGRETMKLTEEQAAAEPAGVRGESPVEGLRDEAGP
PRSCQDPSASSRAAAEAPTREDGQEGGGPGSTVKT
Download sequence
Identical sequences G1PQP0
ENSMLUP00000013414 ENSMLUP00000013414

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]