SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000013586 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000013586
Domain Number 1 Region: 313-479,870-1046
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 5.23e-123
Family Mammalian PLC 0.00000689
Further Details:      
 
Domain Number 2 Region: 622-737
Classification Level Classification E-value
Superfamily SH2 domain 1.62e-30
Family SH2 domain 0.0000208
Further Details:      
 
Domain Number 3 Region: 529-642
Classification Level Classification E-value
Superfamily SH2 domain 2.56e-25
Family SH2 domain 0.00052
Further Details:      
 
Domain Number 4 Region: 1063-1184
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 5.77e-24
Family PLC-like (P variant) 0.0031
Further Details:      
 
Domain Number 5 Region: 767-833
Classification Level Classification E-value
Superfamily SH3-domain 1.44e-19
Family SH3-domain 0.00022
Further Details:      
 
Domain Number 6 Region: 15-131
Classification Level Classification E-value
Superfamily PH domain-like 6.16e-18
Family Pleckstrin-homology domain (PH domain) 0.0059
Further Details:      
 
Domain Number 7 Region: 161-310
Classification Level Classification E-value
Superfamily EF-hand 0.00000000155
Family Calbindin D9K 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000013586   Gene: ENSMLUG00000014908   Transcript: ENSMLUT00000014924
Sequence length 1266
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429802:3794465:3929207:-1 gene:ENSMLUG00000014908 transcript:ENSMLUT00000014924 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTMVNVDALPEYEKSQIKRALELGTVMTVFSFRKSTPERRTVQVIMETRQVAWSKTADK
IEGFLDIMEIKEIRPGKSSKDFERAKTVRQKEDCCFTILYGTQFVLSTLSLAIADSKEDA
TKWLSGLKILHQEAMSASTPTIIESWLRKQIYSVDQTRRNSISLRELKAILPLVNFKVSS
AKFLKDKFAEIGANKDEFSFEQFHLLYKKLMFEQQKSILDEFKKDSSVFILGSTDRPDAS
AVHLHDFQRFLLHEQQELWAQDVNKVRERMTKFIDDTMRETAEPFLFVDEFLTYLFSREN
SIWDEKYDVVDMQDMNNPLSHYWISSSHNTYLTGDQLRSESSPEAYIRCLRMGCRCIELD
CWDGPDGKPIIYHGWTRTTKIKFDDVVQAIKDHAFVTSSFPVILSIEEHCCVEQQRYMAR
VFKEVFGDLLLTKPTEASADQLPSPSQLREKIIIKHKKLGPRGDVDVNMEDKKDEHKQQG
ELYMWDPIDLKWTRHYCAIADAKLSFSDDIEQTVEEEVPQDTPPTELHFGEKWFHKKVEK
RTSAEKLLQEYCSETGGKDGTFLVRESETFPNDYTLSFWRSGRVQHCRIRSTMEGGTMKY
YLTDNLMFTSIYALIQHYRETHLRCAEFELRLTDPVPNPNPHESKPWYYDGLSRGEAEDM
LMRVPRDGAFLIRKREGSDSYAITFRARGKVKHCRINRDGRHFVLGTSAYFESLVELVSY
YEKHALYRKMKLRYPVTPELLERYNMERDINSLYDVSRMYVDPSEINPSMPQRTVKALYD
YKAKQSDELSFCRGALIHNVSKEPGGWWKGDYGTKIQHYFPSNYVEDISTVDVEELEKQI
IEDNPLGSLCKGILDLNTYNKVKAPHGKNQKPFVFILEPKKQGDPPVEFATDRVEELFEW
FQSIRQITWKIDTKENNMKYWEKNQSIAIELSDLVVYCKPTSKTKDNLENPDFREIRSFV
ETKADSVVRQKPIELLKYNQKGLTRVYPKGQRVDSSNYDPFRLWLCGSQMVALNFQTGDK
YMQMNQALFSLNGRTGYVLQPESMRTEKYDPMPPESQRKILMTLTVKVLGARHLPKLGRS
IACPFVEVEICGAEYDNNKFKTTVVNDNGLSPVWASTQEKVTFEIYDPNLAFLRFVVYEE
DMFSDPNFLAHATYPIKGIKSGFRSVPLKNGYSEDIELASLLVFCEMRPVLESEEELYSS
CRQLRRRQEELNNQLFLYDTHQNLRNANRDALVNEFNVNENQLHLYQEKCNRRLREKRVS
NSKFYS
Download sequence
Identical sequences G1PR42
ENSMLUP00000013586 ENSMLUP00000013586

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]