SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000013620 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000013620
Domain Number 1 Region: 118-175,225-437,468-519
Classification Level Classification E-value
Superfamily PP2C-like 6.41e-60
Family PP2C-like 0.0015
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000013620
Domain Number - Region: 166-232
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0273
Family Spectrin repeat 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000013620   Gene: ENSMLUG00000014958   Transcript: ENSMLUT00000014959
Sequence length 530
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430041:473235:474827:1 gene:ENSMLUG00000014958 transcript:ENSMLUT00000014959 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSPVSYWILNSARNSIATLQGGRHLYSRCVSSRNKSKRTLFPWVSSTLKNNAPCGDFAL
PKAYRHTSTEEDDFHLQLSPEQVNEVLRAGESAHKILDPVSGVPNSVLRFESNQLAANSP
VEDRRGVASCLQTNGLMFGVFDGHGGHACAQAVSERLFYYVAVSLMSQQTLEQMEEAMES
MKPMLPILQWLKHPGDSIYKDVTSVHLDHLRVYWQELLDLHMEMGLNIKEALMYSFQRLD
SDISLEIQAPLEDEMTRNLSLQVAFSGATACVAHVDGVHLHVANAGDCRAILGVQEDNGM
WSCLPLTCDHNAWNQAELSRLKREHPESENRTIIMDDRLLGILMPCRAFGDVQLKWSKEL
QRSVLERGFDTEALNIYQFTPQHYYTPPYLTAEPEITYHRLRPQDKFLVLASDGLWDVLD
NEDVVRLVVEHLSEAGRHKPDLAQRPANLGLMQSLLLQRKAQGLHVADQNAATRLIRHAI
GSNEYGEMDPERLTAMLTLPEDLARMYRDDITVTVVYFNSDSIDAYDKRG
Download sequence
Identical sequences G1PR73
ENSMLUP00000013620 XP_006099441.1.53796 XP_014320382.1.53796 XP_014320383.1.53796 ENSMLUP00000013620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]