SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000013630 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000013630
Domain Number 1 Region: 353-573
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.88e-53
Family DBL homology domain (DH-domain) 0.00029
Further Details:      
 
Domain Number 2 Region: 713-775
Classification Level Classification E-value
Superfamily SH3-domain 5.38e-16
Family SH3-domain 0.0017
Further Details:      
 
Domain Number 3 Region: 573-696
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000063
Family Pleckstrin-homology domain (PH domain) 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000013630   Gene: ENSMLUG00000014965   Transcript: ENSMLUT00000014970
Sequence length 798
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430487:189725:197519:1 gene:ENSMLUG00000014965 transcript:ENSMLUT00000014970 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDCGPPATLQPPLAGPPGTACHPVAVCQQESLSFVELPTLQPPRSVCLDLFPVTPEELQA
PGSRWSLGTPAPLQGLLWSPSPGVPDTEISPSGGMRPSRAGSWPHCPSAQPPPLEGPWSP
QHPQPQRRASHGSEKKSAWRKMRVYQSEEAPGSPEAHAVFLEPGQVAEPPLSTEEPRPLE
LAGPTRGGLEGPERRRFSASELMTRLHSSLRLGRHSAARALAQGAGAGAAREGKASGREP
RSAEMRVDGAATAAPVDPSGSPGSGPASRAQGSRSASERRQSRFLLNSVLYQEYSDVASA
RELRRQQREEEGPGDEAEGAEEGPGPPRANLSPSSSFRAQRSARGSTFSLWQDIPDVRGS
GVLATLSLRDCKLQEAKFELITSEASYIHSLSVAVGHFLGSAELSECLGAQDKQWLFSKL
PEVKSTSERFLQDLEQRLEADVLRFSVCDIVLHHCPAFRRVYLPYVTNQAYQERTYQRLL
LENPKFPGILARLEESPVCQRLPLTSFLILPFQRITRLKMLVENILKRTAQGSEDEDMAT
KAFNALKELVQECNASVQSMKRTEELIHLSKKIHFEGKIFPLISQARWLVRHGELVELAP
LPAAPPAKLKLSSKAVYLHLFNDCLLLSRRKELGKFAVFVHAKMAELQVKDLSLKPQGIP
GHVFLLQLLHGQHTKHQFLLRARTESEKQRWISAMCPSSPQEDKEVISEGEDRPQVQCVR
TYKALQPDELTLEKTDILAVRTRTSDGWLEGVRLADGEKGWVPQAYVEEISSLSARLRNL
RENKRITSATSKLGEPPA
Download sequence
Identical sequences G1PR81
ENSMLUP00000013630 ENSMLUP00000013630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]