SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000013658 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000013658
Domain Number 1 Region: 191-428
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 7.59e-60
Family DBL homology domain (DH-domain) 0.0000352
Further Details:      
 
Domain Number 2 Region: 426-552
Classification Level Classification E-value
Superfamily PH domain-like 1.73e-36
Family Pleckstrin-homology domain (PH domain) 0.00082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000013658   Gene: ENSMLUG00000014992   Transcript: ENSMLUT00000015000
Sequence length 1097
Comment pep:novel scaffold:Myoluc2.0:GL430382:78573:98987:-1 gene:ENSMLUG00000014992 transcript:ENSMLUT00000015000 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGAPTASMGNTHSKGSVRDSAPHRPELSFYGSFPRRWGENVFLNNELLTSKILSMLRPQS
EQGFQAGRLHYPAHFLSTNSVFASVTASVKEPPRPTLLSDGSLALSRNAGMTVAQKGSPQ
PAPSQAGTGARLGPVIGEMDEADSVFLKFKQAADDSLSLTSSNAESIFVEDPYTASLRSE
IESDAHEFEAESWSLSVDPAYAKEQKKEVAKRQDVIYELIQTEVHHVRTLKIMLKVYSRA
LQEELQFSSKAISRLFPCADDLLQVHGHFLSRLKERRRESLEEGSDRNYIIQKIGDLLVQ
QFSGENGESMKKKYGVFCSGHNEAVSHYKLLLQQNKKFQNLIKKIGSSSIVRRLGVQECI
LLVTQRITKYPVLVERIIQNTEAGSKDYEDLTQALNLIKDVISQVDTQVSECEKGQRLRE
IAGRMDLKSSSKLKNGLPFRKEDMLQRQLHLEGTLAWKTTAGRLKDVLVVLLTDVLLLLQ
EKDQKYVFASVDSKRPVISLQKLIVREVANEEKAMFLISASLQGPEMYEIYTSSKEERNA
WMAHIRRAVESCPDEEEGPFSEAEEERKVVEARALRLRDFQERLSLKDQQIAQSLREKQQ
IFLEMAEMSGLDDSAQPRLLFRGGDLSENLQGEWILKSAMTEIADIQSLICRRLGGTSGQ
ADRGASAGLHQRAEAFGGSDSTSDPGKSDSCRKKVCGSDLSPGDWQDPVSSPDAKLGDTP
GASEEAPWAVEAPGTESGPRLPTVLELELVQRIQTLSQLLLSLQAVITQQDSYVEMQRAS
IQEREKQFRLQSTRGNLLLEQERQRNFEKQREELAGVQKLQSQLRLEQQRWERQREQQQQ
ELDLAVAHLQQRQSEAARLQEQQAQERAELEQQRQAYQHDLERLREAQRLVQREREQLEL
LQRLKKQNTAPRALPPELPTEAQPPSHAPSFNGEGLEGPERPEVARRDSTPAESRPARSD
VPIQLLSTTNQIQRQAAVQQQIPTKLAAFTKGGKDKGGKSRGSQRSESSASFDLKQQQQQ
LFSKLTGKEEYVSRSHSSLSPVRRSSHRSASPQDLSCQAPSPAVEDTSPECPPFLPVPGP
LTPLDKEEASKEDVIFF
Download sequence
Identical sequences G1PRA5
ENSMLUP00000013658 ENSMLUP00000005492

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]