SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000013669 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000013669
Domain Number 1 Region: 2-115
Classification Level Classification E-value
Superfamily PX domain 7.98e-33
Family PX domain 0.00021
Further Details:      
 
Domain Number 2 Region: 198-295
Classification Level Classification E-value
Superfamily SH3-domain 1.97e-22
Family SH3-domain 0.00096
Further Details:      
 
Domain Number 3 Region: 126-186
Classification Level Classification E-value
Superfamily SH3-domain 2.49e-17
Family SH3-domain 0.0004
Further Details:      
 
Domain Number 4 Region: 338-422
Classification Level Classification E-value
Superfamily SH3-domain 6.3e-16
Family SH3-domain 0.00096
Further Details:      
 
Domain Number 5 Region: 819-885
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000021
Family SH3-domain 0.00088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000013669   Gene: ENSMLUG00000015005   Transcript: ENSMLUT00000015011
Sequence length 887
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430313:169365:222571:1 gene:ENSMLUG00000015005 transcript:ENSMLUT00000015011 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQVYIIRVTWSSGSTEAIYRRYSKFFDLQMQMLDKFPMEGGQKDPKQRIIPFLPGKILFR
RSHIREVAVKRLIPIDEYCKALIQLPPYISQCDEVLQFFETRPEDLNPPKEEHVGKKKSG
SDPTSVDPMVLEQYVVVANYQKQESSEISLSVGQVVDIIEKNESGWWFVSTAEEQGWVPA
TCLEGQDAGQDEFSLEPEEEEKYSVIYPYTARDQDEMNLERGAVVEVIQKNLEGWWKIRY
QGKEGWAPASYLKKSSGEPSSLKLGPGSPAHTGVLDLDGVSRPQNLGGREKEPLSSPRDG
RCEGRPVPDGDVKQRSPKMRQRPPPRRDMTIPRGLNLPKPPIPPQVEEEYYTIAEFQTTI
PDGISFQAGLKVEVIEKNLSGWWYIQIEDKEGWAPATFIDKYKKTSNASRPNFLAPLPNE
MAQLRLGDAAMENSTGGEAGGPSRPLPDAPLGAVDSGIPRSKDWKGGKEVLRKASSDVPC
TGYEEISNLNQEEKPSLPPRKESIIKSEGELQERERQRLEQLRGSSPKPPGMILPMIPAK
HSPPTRDGKKPEPKPDKSKVFQLKNEMGLECGHKVLAKEVKKPNLRPISKSKADPPEEKP
EAMPQNPFLKSKPQVRPKPASSPRIEAPQGEEQVDICNLRSKLRPAKPHEKPLLDGESSH
QAVGGQDAAFSRSFLPGEGPGRAPDRTGKQDGLSPKEIPCRPPPKPAKATDPAPKNAPAP
LKEAPQEAPQQRPVIPPRRPPPPKKTSSPRPLPEPMGPQREANEGRAPPAPGRALLVPPK
AKPFLANSSGGQDDIRGRGGLGPRLAGKMGENREKAAAAPFPSADSPKDLYVAVANFEGD
EDASSFQEGTVFEVREKNSSGWWFCQVLSGAPSWEGWIPSNYLRKKP
Download sequence
Identical sequences G1PRB4
ENSMLUP00000013669 ENSMLUP00000013669

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]