SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000013892 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000013892
Domain Number 1 Region: 157-358
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.84e-51
Family DBL homology domain (DH-domain) 0.00000000443
Further Details:      
 
Domain Number 2 Region: 350-474
Classification Level Classification E-value
Superfamily PH domain-like 1.31e-35
Family Pleckstrin-homology domain (PH domain) 0.0000122
Further Details:      
 
Domain Number 3 Region: 82-153
Classification Level Classification E-value
Superfamily SH3-domain 1.71e-25
Family SH3-domain 0.0000434
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000013892
Domain Number - Region: 2-42
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0122
Family Calponin-homology domain, CH-domain 0.0072
Further Details:      
 
Domain Number - Region: 715-771
Classification Level Classification E-value
Superfamily Oxygen-evolving enhancer protein 3, 0.0196
Family Oxygen-evolving enhancer protein 3, 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000013892   Gene: ENSMLUG00000015239   Transcript: ENSMLUT00000015250
Sequence length 779
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429800:1312660:1389149:-1 gene:ENSMLUG00000015239 transcript:ENSMLUT00000015250 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QTFDANDLYQGQNFNKVLSSLVTLNKVTADIGLGSDSVCARPSSHRIKSFDSLGSQPSHS
RTSKLFQGQYRSLDMTDNSNNQLVVRAKFNFQQTNEDELSFTKGDVIHVTRVEEGGWWEG
THNGRTGWFPSNYVREIKPSEKPVSPKSGTLKSPPKGFDTTAINKSYYNVVLQNILETEN
EYSKELQTVLSTYLRPLQTSEKLSSANTSYLMGNLEEICSFQQMLVQSLEECTKLPEAQQ
RVGGCFLNLMPQMKTLYLSYCANHPSAVNVLTEHSEELGEFMEMKGANSPGILVLTTGLS
KPFMRLDKYPTLLKELERHMEDYHPDRQDIQKSMTAFKNLSAQCQDVRKRKELELQILTE
AIRSWEGDDIKTLGNVIYMSQVMIQCAGSEEKNERYLLLFPNILLMLSASPRMSGFIYQG
KLPTTGMTITKLEDSENHRNAFEISGSMIERILVSCNNQQDLHEWVDHLQKQTKVTSVST
PPIKPHSVPSHTLPTHSITPSSKHADSKSVPLTPAYHTLPHPSHHGTPHTTINWGPLEPP
KTPKPWSLSCLRPAPPLRPSAALCYKEDLSKSPKTMKKLLPKRKPERKPSDEEFALRKST
AALEEDAQILKVIEAYCTSAKTRQTLNSTWQGTDLMHNHVLADDDQSSLDSLGRRSSLSR
LEPSDLSEDSDYDSIWTAHSYRMGSTSRSRKESAPQVLLPEEEKIIVEETKSNGQTVIEE
KSLVDTVYALKDEVQELRQDNKKMKKSLEEEQRARKDLEKLVRKVLKNMNDPSWDETNL
Download sequence
Identical sequences G1PRW1
ENSMLUP00000013892 ENSMLUP00000013892

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]