SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000014344 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000014344
Domain Number 1 Region: 538-1014
Classification Level Classification E-value
Superfamily Ras GEF 2.09e-141
Family Ras GEF 0.0000000000000113
Further Details:      
 
Domain Number 2 Region: 2-148
Classification Level Classification E-value
Superfamily Histone-fold 1.19e-49
Family TBP-associated factors, TAFs 0.00000038
Further Details:      
 
Domain Number 3 Region: 169-371
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 9.81e-43
Family DBL homology domain (DH-domain) 0.00000000284
Further Details:      
 
Domain Number 4 Region: 389-544
Classification Level Classification E-value
Superfamily PH domain-like 6.03e-39
Family Pleckstrin-homology domain (PH domain) 0.000000458
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000014344   Gene: ENSMLUG00000015731   Transcript: ENSMLUT00000015746
Sequence length 1304
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429773:17979485:18051998:1 gene:ENSMLUG00000015731 transcript:ENSMLUT00000015746 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VQGQVHPTLESSDDALQYVEELILQLLNMLCQAQPRSVSDVEERVQKSFPHPIDKWAIAD
AQSAIEKRKRRNPLSLPVEKIHPLLKEVLGYKIDHQVSVYIVAVLEYISADILKLVGNYV
RNIQHYEITKQDIKVAMCADKVLMDMFHQDVEDINILSLTDEEPSTSGEQTYYDLVKAFM
AEIRQYIRELNLIIKVFREPFVSNSKLFSANDVENIFSRIVDIHELSVKLLGHIEDTVEM
TDEGSPHPLVGSCFEDLAEELAFDPYESYARDILRPGFHDRFLSQLSKPGAALYLQSIGE
GFKEAVQYVLPRLLLAPVYHCLHYFELLKQLEEKSEDQEDKECLKQAITALLNVQSGMEK
ICSKSLAKRRLSESACRFYSQQMKGKQLAIKKMNEIQKNIDGWEGKDIGQCCNEFIMEGT
LTRVGAKHERHIFLFDGLMICCKSNHGQPRLPGASNAEYRLKEKFFMRKVQINDKDDTNE
YKHAFEIILKDENSVIFSAKSAEEKNNWMAALISLQYRSTLERMLDVTMLQEEKEEQMRL
PSADVYRFAEPDSEENIIFEENVQPKAGIPIIKAGTVIKLIERLTYHMYADPNFVRTFLT
TYRSFCKPQELLSLIIERFEIPEPEPTEADRIAIENGDQPLSAELKRFRKEYIQPVQLRV
LNVCRHWVEHHFYDFERDAHLLQRMEEFIGTVRGKAMKKWVESITKIIQRKKIARDNGPG
HNITFQSSPPTVEWHISRPGHIETFDLLTLHPIEIARQLTLLESDLYRAVQPSELVGSVW
TKEDKEINSPNLLKMIRHTTNLTLWFEKCIVETENLEERVAVVSRIIEILQVFQELNNFN
GVLEVVSAMNSSPVYRLDHTFEQIPSRQKKILEEAHELSEDHYKKYLAKLRSINPPCVPF
FGIYLTNILKTEEGNPEVLKRHGKELINFSKRRKVAEITGEIQQYQNQPYCLRVESDIKR
FFENLNPMGNSMEKEFTDYLFNKSLEIEPRNPKPLPRFPKKYNYPLKSPGVRPSNPRPGT
MRHPTPLQQEPRKISYSRIPESETESTASAPNSPRTPLTPPPASGASSTTDVCSVFDSDH
SSPFHSSSDTVFIQVTLSHGPRSASVSSISLTKGTDEVPVPPPVPPRRRPESAPVESSPS
KIMSKHLDSPPAIPPRQPTSKAYSPRYSISDRTSISDAPESPPLLPPREPVRTPDVFSSS
PLHLQPPPLGKKSDHSNAFFPNSPSPFTPPPPQTPSPHGTRRHLPSPPLTQEVDLHSIAG
PPVPPRQSTSQHIPKLPPKTYKREHTHPSMHRDGPPLLENAHSS
Download sequence
Identical sequences G1PT16
ENSMLUP00000014344 ENSMLUP00000014344

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]