SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000014409 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000014409
Domain Number 1 Region: 355-615
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.05e-76
Family Protein kinases, catalytic subunit 0.000000000361
Further Details:      
 
Domain Number 2 Region: 5-146
Classification Level Classification E-value
Superfamily PH domain-like 3.01e-46
Family Pleckstrin-homology domain (PH domain) 0.0000432
Further Details:      
 
Domain Number 3 Region: 234-385
Classification Level Classification E-value
Superfamily SH2 domain 5.65e-32
Family SH2 domain 0.00000174
Further Details:      
 
Domain Number 4 Region: 175-256
Classification Level Classification E-value
Superfamily SH3-domain 9.71e-18
Family SH3-domain 0.0000597
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000014409   Gene: ENSMLUG00000015811   Transcript: ENSMLUT00000015818
Sequence length 623
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429823:2374256:2421230:-1 gene:ENSMLUG00000015811 transcript:ENSMLUT00000015818 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SNNSILLEEQLIKKSQQKRRTSPSNFKVRFFVLTKTSLAYFEDRHGKKRTLKGSIELSRI
KCVEIVKSDISIPCHYKYPFQVVHDNYLLYVFAPDRESRQRWVLALKEETRNNNSLVSKY
HPNFWMDGRWRCCAQLEKLAVGCAQYDPSKNASKKPLPPTPEDNRRSLQEHEETLVIALY
DYQTNDPQELTLQRNDEYYLLDSSEIHWWRVQDKNGHEGYVPSSYLVEKSANNLETYEWY
NKSISRDKAEKLLLDTGKEGAFMVRDSRTPGTYTLSVFTKAIVSESNPCIKHYHIKETND
NPKRYYVAEKYVFDSIPLLINYHQHNGGVNPGLVTRLRYPVCSWRQKAPITAGLRYGKWV
IHPSELTFVQEIGSGQFGLVHLGYWLNKDKVAIKTIQEGAMSEEDFLEEAEVMMKLSHPK
LVQLYGVCLEQAPICLVFEFMEHGCLSDYLRSQRGLLAAETLLGMCLDVCEGMAYLEEAC
VIHRDLAARNCLVGENQVIKVSDFGMTRFVLDDQYTSSTGTKFPVKWASPEVFSFSRYSS
KSDVWSFGVLMWEVFSEGKIPYENRSNSEVVEDISTGFRLYKPRLASSHIYQIMNHCWKE
KPEDRPPFSRLFSQLGEIAELGL
Download sequence
Identical sequences G1PT68
ENSMLUP00000014409 ENSMLUP00000014409

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]