SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000014781 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMLUP00000014781
Domain Number - Region: 264-499
Classification Level Classification E-value
Superfamily Tropomyosin 0.0032
Family Tropomyosin 0.0038
Further Details:      
 
Domain Number - Region: 142-247
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00403
Family Spectrin repeat 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000014781   Gene: ENSMLUG00000016221   Transcript: ENSMLUT00000016222
Sequence length 604
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429870:3407722:3418295:1 gene:ENSMLUG00000016221 transcript:ENSMLUT00000016222 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QPPPANPGEETGPGPVAGSEDGIPHPSAPVDPDRPPPSPIPHPHPPPLPRPRPRPRPLPL
GSWRQGRGPPRPACVAGSPRPRSGSAASSSAAAAASSSASCSRRLGRALNWLFYLVLVAA
AAFSGWCVHHVLEEVQEVRRGHQDFCRQREELGQGLQGVEQKVQSLQATLGTFESFLRTF
QHKQELAEKVMKQGESEINRISEVLQKLQNEILKDLSDGIHVVKDARERDFTSLENTVEE
RLTELTKSINDNIAIFTEVQKRSQKEINDVKAKVASLEHSEGDRQELKALKEVVKGIQTS
LKSKDKDLEALRSTLQTMESDVYTEVKELVSLKQEQQKFKEAADSEHLTLQALSEKVLRS
EEATARLPEEVRRLSEELRQLKAQSLEPEEDGVFKNSDTLDALQRKSQGLDTRLQTVEDG
VQAMQMASARQSESLESLLAKSEECEQRLAALQQRLDSLDSSEEADKGSLASTVRSLGEA
QLSLYSDVEELKRSVGELPSAVDTLQKVQEQVHTLLGQDQAQAARLPPEDFLDRLSSLDH
LKSSVSQVEADLKMLRTAVDSLVAYSVKIETNENNLESAKGLLDDLRNDLDRLFVQVEKI
HEKV
Download sequence
Identical sequences G1PU35
ENSMLUP00000014781 ENSMLUP00000014781

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]