SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000015169 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000015169
Domain Number 1 Region: 40-795
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.53e-281
Family Motor proteins 0.000000000121
Further Details:      
 
Domain Number 2 Region: 1992-2108
Classification Level Classification E-value
Superfamily Second domain of FERM 1.15e-22
Family Second domain of FERM 0.0024
Further Details:      
 
Domain Number 3 Region: 1251-1354
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.33e-20
Family First domain of FERM 0.033
Further Details:      
 
Domain Number 4 Region: 2109-2199
Classification Level Classification E-value
Superfamily PH domain-like 2.73e-20
Family Third domain of FERM 0.015
Further Details:      
 
Domain Number 5 Region: 1346-1440
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000000000000262
Family Second domain of FERM 0.0076
Further Details:      
 
Domain Number 6 Region: 1605-1674
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000253
Family SH3-domain 0.0042
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000015169
Domain Number - Region: 793-863
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000319
Family Motor proteins 0.018
Further Details:      
 
Domain Number - Region: 1534-1563
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0897
Family Di-heme elbow motif 0.092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000015169   Gene: ENSMLUG00000016621   Transcript: ENSMLUT00000016646
Sequence length 2213
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429853:735285:798926:1 gene:ENSMLUG00000016621 transcript:ENSMLUT00000016646 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSHPQGDYVWMDLRSGQEFDVPIGAVVKLCDSGQIQVVDDEGNEHWITPQKATHIKPMHP
TSVHGVEDMIRLGDLNEAGILRNLLIRYRDHLIYTYTGSILVAVNPYQLLSIYSPEHIRQ
YTNKKIGEMPPHIFAIADNCYFNMKRNSRDQCCIISGESGAGKTESTKLILQFLAAISGQ
HSWIEQQVLEATPILEAFGNAKTIRNDNSSRFGKYIDIHFNKRGAIEGAKIEQYLLEKSR
VCRQAPDERNYHVFYCMLEGMGEDQRKKLGLGQASDYNYLAMGNCITCEGREDSQEYANI
RSAMKVLMFTDTENWEISKLLASILHLGNLQYEARTFENLDACEVLFSPSLATAASLLEV
NPPDLMNCLTSRTLITRGETVSTPLSREQALDVRDAFVKGIYGRLFVWIVDKINAAIYKP
PSQDVKNSRRSIGLLDIFGFENFAVNSFEQLCINFANEHLQQFFVRHVFKLEQEEYDLES
IDWLHIEFTDNQDALDMIANKPMNIISLIDEESKFPKGTDATMLHKLNSQHKLNSNYIPP
KNNHETQFGINHFAGVVYYETQGFLEKNRDTLHGDIIQLVHSSRNKFIKQIFQADVAMGA
ETRKRSPTLSSQFKRSLELLMRTLGACQPFFVRCIKPNEFKKPMLFDRHLCVRQLRYSGM
METIRIRRAGYPIRYSFVEFVERYRVLLPGVKPAYKQDDLRGTCQRMAEAVLGTHDDWQI
GKTKIFLKDHHDMLLEVERDKAITDRVILLQKVIRGFKDRSNFLKLKNAATLIQRHWRGH
NCRRNYGLMRLGFLRLQALHRSRKLHQQYRLARRRMIQFQARCRAYLVRKAFRHRLWAVL
TVQAYARGMIARRLHRRLRAEYRRRLEAEKMRLAEEEKLRKEMSAKKAKEEAERKHQERL
AQLAREDAERELKEKEEARRKKELLEQMERARHEPVNHSDMVDKMFGFLGTSGGLPGQEG
QAPSGFEDLERGRREMVEEDLDAALPLPDEDEEDLSEYKFAKFSATYFQGTTTHTYTRRP
LKQPLLFHDDEGDQLAALAVWITILRFMGDLPEPKYHTAMSDGSEKIPVMTKIYETLGKK
TYKRELQALQGEGEAQLPEGQKKSSMRHKLVHLTLKKKSKLTEEVTKRLHDGESTVQGNS
MLEDRPTSNLEKLHFVIGNGILRPALRDEIYCQISKQLTHNPSKSSYARGWILMSLCVGC
FAPSEKFVKYLRNFIHGGPPGYAPYCEERLRRTFVNGTRTQPPSWLELQATKSKKPIMLP
VTFMDGTTKTLLTDSATTAKELCNALADKISLKDRFGFSLYIALFDKVSSLGSGSDHVMD
AISQCEQYAKEQGAQERNAPWRLFFRKEVFTPWHNPSEDNVATNLIYQQVVRGVKFGEYR
CEKEDDLAELASQQYFVDYGSEMILERLLNLVPTYIPDREITPLKTLEKWAQLAIAAHKK
GIYAQRRTDSQKVKEDVVNYARFKWPLLFSRFYEAYKFSGPSLPKNDVIVAVNWTGVYFV
DEQEQVLLELSFPEIMAVSSSRECRVLLSLGCSELGCASCHPGWAGLTPAGPCSPCWSCR
GAKLTAPSFTLATIKGDEYTFTSSNAEDIRDLVVTFLEGLRKRSKYVVALQDNPNPAGEE
SGFLSFAKGDLIILDHDTGEQVMNSGWANGINERTKQRGDFPTDCVYVMPTVTMPLREIV
ALVTMTPDQRQDVIRLLQLRAPEPEVRAKPYTLEEFSYDYFRPPPKHTLSRVMVSKARGK
DRLWSHTREPLKQALLKKILGSEELSQEACMAFIAMLKYMGDYPSKRMRSVNELTDQIFE
GALKAEPLKDEVYVQILKQLTDNHIRYSEERGWELLWLCTGLFPPSNILLPHVQRFLQSR
KHCPLAIDCLQRLQKALRNGSRKYPPHLVEVEAIQHKTTQIFHKVYFPDDTDESLQEEQD
VDAAECARQGLGLVLSLFPGAQSSVQQIFAVISVPENDFFFDFVRHLTDWIKKARPVKDG
IVPSLTYQVFFMKKLWTTTVPGKDPMADSIFHYYQELPKYLRGYHKCTREEVLQLGALIY
RVKFEEDKSYFPSIPKLLRELVPQDLIRQVSPDDWKRSIVAYFNKHAGKSKEEAKLAFLK
VIFKWPTFGSAFFEVKQTTEPNFPEILLIAINKYGVSLIDPRTKDILTTHPFTKISNWSS
GNTYFHITIGNLVRGSKLLCETSLGYKMDDLLTSYISQMLTAMSKQRGSRSGK
Download sequence
Identical sequences G1PV29
ENSMLUP00000015169 ENSMLUP00000015169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]