SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000015435 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000015435
Domain Number 1 Region: 101-313
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.89e-62
Family DBL homology domain (DH-domain) 0.0000238
Further Details:      
 
Domain Number 2 Region: 298-424
Classification Level Classification E-value
Superfamily PH domain-like 2.14e-32
Family Pleckstrin-homology domain (PH domain) 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000015435   Gene: ENSMLUG00000016927   Transcript: ENSMLUT00000016934
Sequence length 1383
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430261:125216:196235:-1 gene:ENSMLUG00000016927 transcript:ENSMLUT00000016934 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELSDSDRPVSFGSTSSSASSRDSHGSFGSRMTLVSNSHLGLFPQDKEAGAIKLELIPAR
LVSSSELQRESLAGQQSPDTGSERQPWAQRRVEAHGATKTGAESATSPKLLYVDRVVQEI
LETERTYVQDLKSIVEDYLDCIRDQTKLPLGTEERSALFGNIQDIYHFNSGLLQDLENCE
NDPVAIAECFVSKSEDFHIYTQYCTNYPRSVAVLTECMRNKTLAKFFRERQETLKHSLPL
GSYLLKPVQRILKYHLLLHEIENHLDKDTEGYDVVLDAIDTMQRVAWHINDMKRKHEHAV
RLQEIQSLLTNWKGPDLTSYGELVLEGTFRIQRAKNERTLFLFDKLLLITKKRDDTFTYK
AHIPCGNLMLVEVIPKEPLSFSVFHYKNPKLQHTVQAKSQQDKRLWVLHLKRLILENHAA
KIPAKVKNALDIIKALYYPGFCYSPEGQAKTCSTPYRLRRKSEPSSRSHKVLKTSETSQD
IKRVSRGEGSPQRRSAGPSPSQRNSQPSGSAILSVLRGGGAVRNIWTDHQIRQALFPQRR
AQENEEEDDDYQMFVPSFSSSDLNSSRLCEDSTSSRPCSWHLGQMEATEAASSGHRVVRR
ASSAGESNTCPPEVRTRDSDGSRYSPQRELQNDPKTEGQDGMTPFGSSIELTLDDIDHVY
DNISYEDLKLMVAQREEAESTPPRSARDSVRPKSTPELAFSKGHAGHEKSPLHTKRGGPR
PGREASNQSVHELEVVEENIYDTIRLPDPPSLDFRCSSLTRPKRSTFLGLEADFPCCDTL
RPFVSQDSLQLSEDEAPYQPGPSDNDYLSLLYNSFGCNLSIAEKSISDKLSEEVDEIWND
LENYIKKNEVKARDRLLAAFPVSKDDVADRLHSESAPELSQDAARALSTLSLPESRALLT
LQDRPGRASRASCPLGEDLLSKEGSFLSLNRLSLASEGPPLENPYDLATSSLSQVDLDSP
DPGVDATDKTKSRVFMMARQYSQKIKKANQLLKVKSPEVEQPPASQPHRSVHKDLAAILE
DKKQGGPAIGARIAEYSQVYDQIVFRETPFKTQKDGWARPQESSTLRSTSPSQAQRGSED
WLLHSTYSNGELADFCHRPGQDLKPKYPTLEIHTKNIPRHLSTACSVPSLQTSDHLLGSI
QRHSVVVSQPNKENSCQGHLYNSLGRKGFSAKSQPYNRSQSSSSILINKSADSINYPNEV
GRKQLLSLHNSSKCESHQDLPPGISGSCQQGTGKRSDLTLQDSQKVLVVNRNLPLNAQIA
TQNYFSNFKETEGDEDDYVEIKSEEDEAELELSHNRRKKSDPKIVDADFSDNVGSNNTSY
SLHSPCTPRKPVSGKLGVSPYLTPYHDSDKLNDYLWRGPSPNQQNIVQSLREKFQCLSSS
SFA
Download sequence
Identical sequences G1PVQ7
ENSMLUP00000015435 ENSMLUP00000015435

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]