SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000015489 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000015489
Domain Number 1 Region: 1074-1264
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.23e-40
Family DBL homology domain (DH-domain) 0.0000327
Further Details:      
 
Domain Number 2 Region: 1274-1388
Classification Level Classification E-value
Superfamily PH domain-like 3.23e-34
Family Pleckstrin-homology domain (PH domain) 0.00034
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000015489
Domain Number - Region: 506-663
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.0115
Family CRAL/TRIO domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000015489   Gene: ENSMLUG00000016985   Transcript: ENSMLUT00000016992
Sequence length 1447
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429767:48846955:48888846:1 gene:ENSMLUG00000016985 transcript:ENSMLUT00000016992 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QDLESLDAYIQNTLSDLYPPFEATAATVLWQVFSVAERLHGGDGLRCLTDFLIPATRALQ
HLQREACARYTGLIFFHEGWPLCIHGKVVVQLASLRGVRLRPGDFYLQVTSVGKQSARLV
LKCLSRLGRGSEEVAVPEAMYGCVFTGEFLDRVNRERNSVLLKNCLLTSGSAVYRTPWSN
VTVPVFVPISGRVLPHCPSHPGPERPPSSASEAPAPAPAMASNTPTLPHCGGHKDSDQPS
HLPSLKRAECKSPGTLPRSSDVSPWEPRASPEGPGGRPDPVDKKDGPQALTSPEDAGSLS
SSRRPPGAPAAVEARRWFRNSYMEALQNPMPLGSSSEESLVDDACSTLSKRAAPGSSQPQ
KETPGPQGERQGIRRRQSCPRAAGRTLPRRSQSWDRSLKSFRGDAPHSASAGPRECSVKN
KNNDCGKKQKEGRKTLKPSSSEKAVQLHDVSTEEHTCPRWCGTPAVPPEMGSPDLLAELL
CSEDEGQPPSTGDLPSQVPRQVLEINLELLQSGAVTLPGTRDRQGRAVVQVCTRGPLWSS
QHMSSAELTLLLKYLHGIPRKEVRDLGLVILVDTRKSPAVPALSQALAALQENISPPIIH
SILLLVDKDSAFRPDKDAAIQCEVVGSLKALHKFVDSSQLTADLEGSFPYSHSDWICFRR
KLETFVTNCQDAIAFLQNLVSSLSTHRTLSTAQEVTELISEHKAIMKQVLEDALLVTLRL
EGGTVLARLRRKEQGASEDSRDSIEAASRLYNQVDEEVHRLVLTSNRCLQELESLQELRA
LQEEHLLLTGAGGRDRRPSAQPGQGLSALLMTEMAFSTLRTDLSSWAPNSRGSLALLSST
TSLKTISWFQAIIRGVRGGQHRAGQRQAISACCHVWLPGSPAPHCGCLDGRTTLELVAEC
LKSCPQDARGVLASVAVLGLGSQQALQQWHALWLQCQQMHLCSQEALFEAAPGPGATPPD
QGPLKHELIDQGAEMRLREPSWTPLTDPQGCAGERAQLLSSLPGQVTFCGQDAEMPQLDS
SPRDSHWPAHTGGFIKGLDVASTVASEKKPPLRPHAKSPLVTRNRSLSSPSRIHTSEEDR
RRPAGSSRLQHIMAEMISTEREYVRSLGYVVDNYFPEMERVDLPPDLRGKRSIIFGNLEK
LYNFHQQHFLTELERCRHCPLAAGRGFLRHEEQFGMYALYSKNKPQSDALLCSHGLDKQQ
ALGDKMDLASYLLKPVQRMGKYALLLQDLVKEAGRCPAHEQELAELKAAEDMVRFQLRHG
NDLLALDAVRRCHVNLKEQGQLRCRDEFIVYCGRKKYLRHVFLFEDLILFSKTRKVDGSY
DIYTYKQSFKMAEIGLTETVGDSGAKFEIWFRRRRKSQDSYILQASSPEVKAMWTDVIGK
ILWRQVLRNRELRMQEIVSMGLGSTPFLDIKPSDAALSDQAAEYNMNGTESRAHASTAVP
ACNHPTP
Download sequence
Identical sequences G1PVV2
ENSMLUP00000015489 ENSMLUP00000015489

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]