SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000015522 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000015522
Domain Number 1 Region: 2278-2516
Classification Level Classification E-value
Superfamily Plakin repeat 6.15e-88
Family Plakin repeat 0.0000000497
Further Details:      
 
Domain Number 2 Region: 2861-3099
Classification Level Classification E-value
Superfamily Plakin repeat 1.05e-87
Family Plakin repeat 0.0000000212
Further Details:      
 
Domain Number 3 Region: 1619-1859
Classification Level Classification E-value
Superfamily Plakin repeat 4.45e-84
Family Plakin repeat 0.0000000645
Further Details:      
 
Domain Number 4 Region: 2619-2856
Classification Level Classification E-value
Superfamily Plakin repeat 1.26e-76
Family Plakin repeat 0.000000914
Further Details:      
 
Domain Number 5 Region: 1947-2186
Classification Level Classification E-value
Superfamily Plakin repeat 8.89e-76
Family Plakin repeat 0.000000516
Further Details:      
 
Domain Number 6 Region: 3172-3213,3248-3441
Classification Level Classification E-value
Superfamily Plakin repeat 1.4e-67
Family Plakin repeat 0.00000033
Further Details:      
 
Domain Number 7 Region: 126-312
Classification Level Classification E-value
Superfamily Spectrin repeat 9.18e-19
Family Spectrin repeat 0.0054
Further Details:      
 
Domain Number 8 Region: 3119-3167
Classification Level Classification E-value
Superfamily Plakin repeat 0.000000000228
Family Plakin repeat 0.0089
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000015522
Domain Number - Region: 16-125
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000112
Family Spectrin repeat 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000015522   Gene: ENSMLUG00000017008   Transcript: ENSMLUT00000017027
Sequence length 3473
Comment pep:known_by_projection scaffold:Myoluc2.0:GL431924:11537:25230:-1 gene:ENSMLUG00000017008 transcript:ENSMLUT00000017027 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QKAQAEVEGLGKGVARLSEEAEKVLALPEPSPAAPTLRSELELTLVKLEQVRSLSAIYLE
KLKTISLVIRSTQGAEEVLRGHEEQLKEAQAVPSTLPELEATKAALKKLRAQAEAQQPVF
DALRDELRGAQEVGERLQQRHGERDVEVERWRERVAQLLERWQAVLAQNDLRQRELEQLG
RQLRYYRESADPLGAWLQDAKQRQEQIQALPLANSRAVREQLRQEKALLEEVERHGEKVE
ECQRFAKQYINAIKDYELQLITYKGQLEPVASPAKKPKVQSGSESVIQEYVDLRTRYSEL
TMLTSQYIKFLSETLRRMEEEERLAEQQRAEERERLAEVEAALEQQRQLAETHAQAKAQA
EREAQELQRRMQEEVVRREEAAVDAQQQKRSIQEELQHLRQSSEAEIQAKAQQAEEAERS
RVRIEEEIRVVRLQLETTERQRSGAEGELQALRARAEEAEAQKRQAQEEAERLRRQVQEE
TQRKRQAEAELALRVKAEAEAAREKQRALQALEELRLQAEEADRRLRQAEVERTRQVQVA
LETAQRSAAAELQSKRASFAEKTAQLERTLQEEHVTVTQLREEAERHAQQQAEAERAREE
AERELERWQLKANEALRLRLQAEEVAQQKSLAQAEAEKQKEEAEREARRRGKAEEQAVRQ
RELAEQELEKQRQLAEGTAQQRLAAEQELIRLRAETEQGEQQRLLLEEELGRLQREAAEA
KQKRQELEAELAKVRAEMEVLLASKARAEEESRSTNEKSKQRLEAEAGRFRELAEEAARL
RALAEEAKRQRQLAEEDAARQRAEAERVLTEKLATISEAARLKTEAEIALKEKEAENERL
RRLAEDEAFHRRRLEEQAAQHKADIEERLAQLRKASESELERQKGLVEDTLRQRRQVEEE
ILALKASFERAAAGKAELELELVRIRSNAEDTQRSREQAELEATRQRQLAAEEEQRRREA
EERVQKSLAAEEEAARQRKAALEEVERLKAKVEEARRLRERAEQESARQLQLAQEAAQKR
LQAEEKAHVFAVQQKEQELQQTLQQEQSVLERLRGEAEAARRAAEEAEEAREQAEREAAQ
SRLQVEEAERLKQSAEQEAQARAQAQASAEKLRKEAEQEAKRRAQAEQAALRQKQAADAE
MEKHKKFAEQTLRQKAQVEQELTTLRLQLEETDHQKGILDEELQRLKAEVTEAARQRSQV
EEELFSVRVQMEELGKLKARIEAENRALILRDKDNTQRFLEEEAEKMKQVAEEAARLSVA
AQEAARLRQLAEEDLAQQRALAEKMLKEKMQAVQEATRLKAEAELLQQQKELAQEQARRL
QEDKAQMEQQLAQETQGFQRTLEAERQRQLEMSAEAERLKLRVAEMSRAQARAEEDAQRF
RKQAEEIGEKLHRTELATQEKVTLVQTLEIQRQQSDQDAGRLREAIAELEREKEKLKQEA
RLLQLKSEEMQTVQQEQLLQETQALQQTFLSEKDSLLQREHLIEQEKAKLERLFQDEVAK
AKTLREEQQRQQQQMEQEKQQLVASMEEARRRQREAEEGVRRKQEELQRLEQQRQAQEKL
LAEENQKLRERLQRLEEEHRAALAHSQEIVASQAAAAAKTLPNGREAPDGPEAEPEFAFD
GLRRKVPAQRLQDVGVLRPEELQRLAQGRTTVAELAQREDXRRYLQGSSSIAGLLLEPAR
EKLSVYAALQRQLLSPGTALILLEAQAASGFLIDPVRNRRLTVNEAVKEGLVGPELHHKL
LSAERAVTGYKDPYTGEQISLFQAMKKDLIVRDHGIRLLEAQIATGGIIDPVHSHRVPVE
VAYKNGYFDEEMNRVLADPSDDTKGFFDPNTHENLTYLQLLERCVEDPETGLRLLPLTDQ
AAKGGELVYTDAEARDVFRKATISAPFGSFQGRTVTIWEIINSEYFTAEQRRDLLRQFRT
GKVTVEKIIKIVITVVEEHEQKGQLCFEGLRALVPAAELLESRVINRDLLRQLQQGERSV
REVAELDAVRQALRGSDVIAGVWLEEAGQKMSLYEALKRDLLQPEAAVALLEAQAGTGHI
IDPATSTRLTVDEAVRASLVGPELHERLLSAEKAVTGYKDPYSGQSVSLFQALKKGLIPR
EQGLRLLDAQLSTGGIVDPSKSHRVPLDVAYTRGFLDKETRKVLKGPRDEAKTYVDPRTR
EPATYGQLQQQCRPDPLTGLSLLPLSEKAARARQDELYSELQAREAFEKATVEVPAGSFQ
GRTVTVWELIHSEYFTEEQRRELLQQYRTGKVTVEKILKIVITIVEEVETVRRERLSFSG
LRAPVLASELLASGVLSQAQFEQLQEGKTSVKDLSEVDSVRTLLQGSGCLAGVYLEDSKE
KVTIYEAMRRGLLRPSTATLLLEAQAATGFLVDPVRNQRLYVHEAVKAGVVGPELHERLL
SAEKAVTGYKDPYSGSTISLFQAMKKGLIVREHGIRLLEAQIATGGIIDPVHSHRLPVHV
AYQRGYFDEEMNRVLADPSDDTKGFFDPNTHENLTYLQLLERCVRDPETGLRLLPLKGAE
KAEVVETTQVYTEEETRKAFEETQIEIPGGGGGGGGPGGSTMSLWEVMQSDLIPEDQRTR
LMADFQAGRVTKERMIIIIIEIIEKTEIVRQQNLASYDYVRRRLTAEDLYEARIISREAC
RLLREGTKSLREVLEAESAWRFLYGTGCVAGVYLPGSQQTLTVYQALKKGLLSAEVARLL
LEAQAATGFLLDPVKGERLTVDEAVRKGLVGPELHDRLLSAERAVTGYRDPYTEQPISLF
QAMKKDLIPAEEALRLLDAQLATGGIVDPRLGFHLPLEVAYQRGYLNKDTHDRLSEPSEV
RAYLDPSTDERLSYTQLLRRCRRDDGSGQLLLPLSDARKLTFQGLRKQITVEELVRSRVM
DEATARQLQEGLASVEEVTKTLQKFLEGTSCIAGVLVDATKERLSVYQAMKKGIIRPGTA
FELLEAQAATGYVIDPIKGLKLTVEEAVRMGIVGPEFKDKLLSAERAVTGYRDPYTGKLI
SLFQAMKKGLILKDHGIRLLEAQIATGGIIDPEESHRLPVEVAYQRGLFDEEMNEILTDP
SDDTKGFFDPNTEENLTYLQLMERCVPDPQTGLCLLPLKEKKRERKTSSKSSVRKRRVVI
VDPETGKEMSVNEAYRKGLIDHQTYLELSEQECEWEEITISSSDGVVKSMIIDRRSGRQY
DIDEAITKNLIDRSVLDQYRAGTLSITEFADMLSGNAGGFRSRSSSVGSSSSYPISPAAS
RTQLASWSDPAEETGPVAGILDTETLEKVSITEAMHRNLVDNITGQRLLEAQACTGGIID
PGTGERFPVADAVGKGLVDKVMVDRINLAQKAFHGFEDPRTKTKMSAAQALKKGWLYYEA
GQRFLEVQYLTGGLIEPDTPGRVPLDEALQRGTVDARTAQKLRDVAYAKYLTCPKTKLKI
SYKDALDRSMVEEGTGLRLLEAAAQSSKGYYSPYSVSGSGSTGSRTGSRTGSR
Download sequence
Identical sequences G1PVX6
ENSMLUP00000015522 ENSMLUP00000015522

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]