SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000015858 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000015858
Domain Number 1 Region: 252-472
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.36e-54
Family DBL homology domain (DH-domain) 0.0000824
Further Details:      
 
Domain Number 2 Region: 463-600
Classification Level Classification E-value
Superfamily PH domain-like 1.34e-19
Family Pleckstrin-homology domain (PH domain) 0.025
Further Details:      
 
Domain Number 3 Region: 598-672
Classification Level Classification E-value
Superfamily SH3-domain 3.68e-17
Family SH3-domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000015858   Gene: ENSMLUG00000017390   Transcript: ENSMLUT00000017393
Sequence length 708
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429770:28010298:28070770:-1 gene:ENSMLUG00000017390 transcript:ENSMLUT00000017393 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METKDSDHLEKPQKKSVDGPWELADEPANVRPELLSEEEKMPQADLIQDKEPRYHNLIQR
NSIFNRTVRRRSKGKARNTPKSNAGHLADSPENGKSVKELPALNFSQNRTPLWPIETQTD
PGAKRTSESPSTPGNGATPEECPALADSPTTLTEALQMIHPIPADSWRNLIEQIGLLYQE
YRDKSTLQEIETRRQQDAEIQADDLRSPSSEETPEEEEEEEQEELASPPERRALPQICLL
SNPHSRFNLWQDLPEIQSSGVLDILQPEEIKLQEAMFELVTSEASYYKSLNLLVSHFMEN
ERLKKILHPSEAHILFSNVLDVMAVSQRFLLELERRMEENIVISDVCDIVYHYAANHFSV
YITYVSNQTYQERTYKQLLQEKAAFRELIAQLELDPKCRGLPLSSFLILPFQRITRLKLL
VQNILKRVEERSERECTALDAHKELELVVKACNEGVRKMSRTEQMISIQKKMEFKIKSVP
IISHSRWLLKQGELQQMSGPKTSRTLRTKKLFQEIYLFLFNDLLVICRQIPGDKYQVFDS
APRGLLRVEELEDQGQTLANVFILRLLENADDREATYMLKASSQSEMKRWMTSLAPNRRT
KFVSFTSRLLDCPQVQCVHPYVAQQPDELTLELADILNILDKTEDGWIFGERLHDQERGW
FPSNMTEEILNPKIRSQNLKECFRVHKMDDPQRSQNKDRRKLGSRNRQ
Download sequence
Identical sequences G1PWR9
ENSMLUP00000015858 ENSMLUP00000015858 XP_006082718.1.53796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]