SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000015922 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000015922
Domain Number 1 Region: 382-507
Classification Level Classification E-value
Superfamily EF-hand 2.77e-44
Family EF-hand modules in multidomain proteins 0.0000104
Further Details:      
 
Domain Number 2 Region: 510-604
Classification Level Classification E-value
Superfamily EF-hand 2.31e-34
Family EF-hand modules in multidomain proteins 0.0000355
Further Details:      
 
Domain Number 3 Region: 586-672
Classification Level Classification E-value
Superfamily RING/U-box 8.12e-18
Family ZZ domain 0.013
Further Details:      
 
Domain Number 4 Region: 220-341
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000446
Family Spectrin repeat 0.0074
Further Details:      
 
Domain Number 5 Region: 78-176
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000605
Family Spectrin repeat 0.0094
Further Details:      
 
Domain Number 6 Region: 344-381
Classification Level Classification E-value
Superfamily WW domain 0.0000000000193
Family WW domain 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000015922   Gene: ENSMLUG00000017463   Transcript: ENSMLUT00000017467
Sequence length 959
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429780:769752:797499:-1 gene:ENSMLUG00000017463 transcript:ENSMLUT00000017467 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPMVMQGCPYTFPRCHEWQATDHFHHSNSLRSTCPQLQVRAAAISPVPPQDGAGVFCLS
TKLFNGSVGTSGPLEPSAMNLCWNEIKKKSHNLRARLEAFSDHSGKLQLSLQEIIDWLSQ
KDEELSAQLPLQGDVALVQQEKETHAAFMEDVKSRGPYIYSVLESAQAFLSQHPFEELEE
PRLESKDTSPRQRIQNLSRFVWKQATVASELWEKLTARCVDQHRHIERTLEQLLEIQGAM
EELSTTLTQAEGVRATWEPIGDLFIDSLPDHIQALKLFKEEFSPMKDGVKLVNDLAHQLA
ISDVHLSMENSRALEQINIRWKQLQVSVGERLKQLQDAHRDFGPGSQHFLSTSVQVPWER
AISPNRVPYYINHQAQTTCWDHPKMTELYQTLADYSNIKFSAYRTAMKLRRVQKALRLDL
VTLTTALEIFNEHDLQASEHVMDVVEVIHCLTALYERLEEERGILVNVPLCVDMSLNWLL
NVFDRPSGRSGKMRALSFKTGIACLCGTEVKEKLEYLFSQVANSGSQCDQRHLGVLLHEA
IQVPRQLGEVAAFGGSNVEPSVRSCFRFSTGKPVIEASQFLEWVNLEPQSMVWLAVLHRV
TIAEQVKHQTKCSICRQCPIKGFRYRSLKQFNVDICQTCFLTGKASKGNKLHYPIMEYYT
PTTSSENMRDFATTLKNKFRSKHYFSKHPQRGYLPVQSVLEAEYSDTPASSPRLPHADTH
SRIEHFASRLAEMENQNCSFFNDSLSPDDSIDEDQYLLRHSSPITDREPGFGQQVPCSMA
TENKGELEKVLAHLEDENRILQGELRRLKWQHEEAAEAPTLAEGSAEVAQDHRNEELLAE
ARILRQHKSRLETRMQILEDHNKQLESQLQRLRELLLQPPNESNGNGSAGSSLASSPQQS
EGSHPQEKGQTTPDTEAADDVGSKSQNVSLCLEDIMEKLRHAFPSVRSSDVTANTLLAS
Download sequence
Identical sequences G1PWX5
ENSMLUP00000015922 ENSMLUP00000015922

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]