SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000015970 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000015970
Domain Number 1 Region: 1-130
Classification Level Classification E-value
Superfamily ENTH/VHS domain 4.22e-45
Family VHS domain 0.00015
Further Details:      
 
Domain Number 2 Region: 182-254
Classification Level Classification E-value
Superfamily SH3-domain 4.86e-22
Family SH3-domain 0.0000868
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000015970
Domain Number - Region: 293-364
Classification Level Classification E-value
Superfamily GAT-like domain 0.0152
Family GAT domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000015970   Gene: ENSMLUG00000017515   Transcript: ENSMLUT00000017518
Sequence length 523
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429888:2070704:2116281:-1 gene:ENSMLUG00000017515 transcript:ENSMLUT00000017518 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EKATSEMNTAEDWGLILDICDKVGQSRTGPKDCLRSIMRRVNHKDPHVAMQALTLLGACV
SNCGKIFHLEVCSRDFASEVSNVLNKGHPKVCEKLKALMVEWTDEFKNDPQLSLISAMIK
NLKEQGVTFPAIGSQAAEQAKASPALVAKDPGTVTNKKEEEDLAKAIELSLKEQKQQSTT
LSTLYPSTSNLLTNHQHEGRKVRAIYDFEAAEDNELTFKAGEIITVLDDSDPNWWKGETH
QGMGLFPSNFVTADLTAEPEMIKTEKKTVQFSDDVQVETIEPEPEEQAFIDEDKMDQLLQ
MLQSTDPSDDQPDLPELLHLEAMCHQMGPLIDEKLEDIDRKHSELSELNVKVMEALSLYT
KLMNEDPMYSMYAKLQNQQYYMQSSGVSASQVYPGPQSGTYLLAGNAQMSHLQSYSLPPE
QLSSLSQGAVQPSANPALPAQQTQASYPSSMVSSVQGNTYPSQASVYSPPPAAAPADVTI
YQNAGTNMSHVPNYSLTSSALPQPGGSQQPPQPQQPYSQKALL
Download sequence
Identical sequences G1PX16
ENSMLUP00000015970 ENSMLUP00000015970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]