SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000016017 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000016017
Domain Number 1 Region: 1376-1427,1473-1653
Classification Level Classification E-value
Superfamily VPS9 domain 1.05e-40
Family VPS9 domain 0.0022
Further Details:      
 
Domain Number 2 Region: 13-218
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 6.93e-37
Family Regulator of chromosome condensation RCC1 0.0051
Further Details:      
 
Domain Number 3 Region: 518-685
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 1.2e-27
Family beta-lactamase inhibitor protein-II, BLIP-II 0.075
Further Details:      
 
Domain Number 4 Region: 1045-1134
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 1.19e-23
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.0087
Further Details:      
 
Domain Number 5 Region: 1139-1247
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 8.11e-19
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.024
Further Details:      
 
Domain Number 6 Region: 925-1012
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000892
Family Pleckstrin-homology domain (PH domain) 0.024
Further Details:      
 
Domain Number 7 Region: 690-889
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.000000000249
Family DBL homology domain (DH-domain) 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000016017   Gene: ENSMLUG00000017564   Transcript: ENSMLUT00000017568
Sequence length 1655
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429770:6608017:6648727:-1 gene:ENSMLUG00000017564 transcript:ENSMLUT00000017568 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSKKRSSTKAEGSKERGLVHVWQAGSCSVTPERLPGWGERTVLQAALGVKHGVLLTEDG
AVYSFGTLPWRSAPAETCPSSPVLEHALVGQCVVTVAAGSFHSGAVTESGVVYMWGENSA
GQCAVANQQWVPEPSAVSIADSETSPSLAVRILQLACGEEHTLALSISREIWAWGTGCQL
GLMTTTFPVTKPQKVEHLAGRVVLQVACGAFHSLALVQCPPSQKPVPERCNQCSQLLMTM
TDKEDHVIISDSHCCPLGVTLAESQAENQASTAISPSTETRDSQGEVFENTHIQQDLAVA
NKLNVGNVQTTSGDAVPPQLDIIGTTETSSARNIPSDPDAPAGNEHVQKPSDPSKRENSE
NGEKPVPSQPLVEEAVPNLHSPPTTSTSALNSLVVSCASAVGVRVAATYEAGALSLKKVM
NFYSTAPCEPGAQAGSSSIGPEGLKDSREEQVKQESMQGKKSSSLVDIREEESEGGSRRL
SLPGLLSQVSPRLLRKAARVKTRTVVLTPTYSGEADALLPSLRTEVWTWGKGKEGQLGHG
DVLPRLQPLCVKCLDGKEIIHLEAGGYHSLALSAKSQVYSWGSNTFGQLGHSDFPTTVPR
LAKVKSDNGVWSVAAGQDYSLFLVDTEDFQPGLYYSGRQDLTEGDNLPENPSGAKAPVLL
SCSKLGYISRVAAGRDSYLALVDKNIMGYIASLHELAATERRFYSKLSDIKSQILRPLLS
LENLGTASTVQLLQEVASRFSKLCYLIGQHGASLSSFLQGVKEASSLVILKHASLFLDSY
TEYCTAITHFLVMGGFQLLAKPAIDFLNKNQELLQDLSEVTDENIQLIEILNTLFFLPTR
RLHNYAEVLLKLATCFEVTSPEYQKLQDSSSCYECLALHLGRKRKEAEYTLGFWKTFPGK
MTDSLRKPERRLLCESSNRALSLQHAGRFSVNWFILFNDALVHAQFSTHHVFPLATIWAE
PLSEEAGGVNGLKITTPEEQFTLISSTPQEKTKWLRAISQAVDQALRGASDHPPYGGGSS
IQRQEPPISRSAKYTFYKDPRLKDATYDGRWFSGKPHGRGVLKWPDGKMYSGTFRNGLED
GYGEYRIPNKALSKEDHYVGHWKEGKMCGQGVYSYASGEVFEGCFQDNMRHGHGLLRSGK
LTSSSPSMFIGQWVMDKKSGYGVFDDITSGEKYMGMWQDDVCQGNGVVVTQFGLYYEGNF
HLNKMMGNGVLLSEDDTIYEGEFSDDWTLNGKGTLTMPNGDYIEGYFSGEWGSGIKITGT
YFKPSLYESDKDKPKVFRKLGNLAVPADEKWKAVFDECWHQLGCESPGQGEVWKAWENIA
VALTANRRQHRDSPEILSRSQTQTLESLEFIPQHVGAFSVEKYDDIKKYLIKACDTPLHP
LGRLVETLVAVYRMTYVGVGANRRLLQEAVKEIKSYLKRIFQLVRFLFPELPEEGSTIPL
SAPLPTERKSFCTGKSDSRSESPEPGYVVTSSGLLLPVLLPRLYPPLFMLYALENDREED
VYWECVLRLNKQPDIALLGFLGVQRKFWPVTLSILGETKKVLPTTKDACFASAVECLQQI
STTFTPSDKLKVIQQTFEEISQGVLASLQEDFLWSMDDLFPVFLYVVLRARIRNLGSEVH
LIEDLMDPYLQHGEQGIMFTTLKACYYQIQREKLN
Download sequence
Identical sequences G1PX60
ENSMLUP00000016017 ENSMLUP00000016017 XP_006082474.1.53796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]