SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000016233 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMLUP00000016233
Domain Number - Region: 15-103
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0496
Family Spectrin repeat 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000016233   Gene: ENSMLUG00000017793   Transcript: ENSMLUT00000017797
Sequence length 343
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429812:6238403:6342940:-1 gene:ENSMLUG00000017793 transcript:ENSMLUT00000017797 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPTPPGPLGDCLRDWEELQQDFQSIQETHRQYRLKLEELIKLQNSCTSSITRQKKKLQE
LALILKKCKPSLPAGVQEASKELENQIKERQGLFFDMEAYLPKKNGLYLSLVLGNVNVTL
LSKQAKFAYKDEYEKFKLYLTIILILISFTCRFLLNSRVTDAAFNFLLVWYYCTLTIRES
ILINNGSRIKGWWVFHHYVSTFLSGVMLTWPDGLMYQKFRNQFLSFSMYQSFVQFLQYYY
QSGCLYRLRALGERHTMDLTVEGFQSWMWRGLTFLLPFLFFGHFWQLFNALTLFSLARDP
ECKEWQVLMCGLPFLILFLGNFFTTLRVVHQKFHSQRHRSKKD
Download sequence
Identical sequences G1PXQ1
XP_006088316.1.53796 ENSMLUP00000016233 ENSMLUP00000016233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]