SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000016352 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000016352
Domain Number 1 Region: 36-163
Classification Level Classification E-value
Superfamily Spectrin repeat 3.11e-18
Family Spectrin repeat 0.0068
Further Details:      
 
Domain Number 2 Region: 186-313
Classification Level Classification E-value
Superfamily Spectrin repeat 3.01e-17
Family Spectrin repeat 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000016352   Gene: ENSMLUG00000028091   Transcript: ENSMLUT00000022264
Sequence length 314
Comment pep:novel scaffold:Myoluc2.0:GL429787:8835849:8907126:-1 gene:ENSMLUG00000028091 transcript:ENSMLUT00000022264 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQQDQCCSPRFKLKMLHRKTYHVKDLQGEIEAHTDIYHNLDENGQKILRSLEGSDEAVLL
QRRLDNMNFKWSELRKKSLNIRSHLEASSDQWKRLHLSLQELLVWLQLKDDELSRQAPVG
GDFPTVQKQNDVQRAFKRELKTKEPVIMSTLETVRIFLTEQPLEGLEKLYQEPRELPPEE
KAQNVTRLLRKQAEEVNTEWEKLNLHSADWQRKLDEALERLQELQEATDELDLKLRQAEV
IKGSWQPVGDLLIDSLQDHLEKVKALRGEIAPLKENVSHVNDLARQLTTLGIQLSPYNLN
ILEDLNTRWKLLQV
Download sequence
Identical sequences G1PY20
ENSMLUP00000016352 ENSMLUP00000016352

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]