SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000016474 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000016474
Domain Number 1 Region: 1090-1166
Classification Level Classification E-value
Superfamily SH3-domain 3.02e-25
Family SH3-domain 0.0000492
Further Details:      
 
Domain Number 2 Region: 244-334
Classification Level Classification E-value
Superfamily EF-hand 9.22e-21
Family Eps15 homology domain (EH domain) 0.0025
Further Details:      
 
Domain Number 3 Region: 729-803
Classification Level Classification E-value
Superfamily SH3-domain 5.12e-20
Family SH3-domain 0.00013
Further Details:      
 
Domain Number 4 Region: 874-951
Classification Level Classification E-value
Superfamily SH3-domain 2.36e-19
Family SH3-domain 0.0000837
Further Details:      
 
Domain Number 5 Region: 950-1012
Classification Level Classification E-value
Superfamily SH3-domain 7.88e-19
Family SH3-domain 0.00011
Further Details:      
 
Domain Number 6 Region: 1027-1096
Classification Level Classification E-value
Superfamily SH3-domain 9.06e-18
Family SH3-domain 0.0000746
Further Details:      
 
Domain Number 7 Region: 1385-1516
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000075
Family Pleckstrin-homology domain (PH domain) 0.000008
Further Details:      
 
Domain Number 8 Region: 15-65
Classification Level Classification E-value
Superfamily EF-hand 0.0000000783
Family Eps15 homology domain (EH domain) 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000016474   Gene: ENSMLUG00000029304   Transcript: ENSMLUT00000027283
Sequence length 1650
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430324:275865:377428:1 gene:ENSMLUG00000029304 transcript:ENSMLUT00000027283 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQFPTPFGGSLDVWAITVEERAKHDQQFHSLKPVSGFITGDQARNFFFQSGLPQPVLAQ
ICHFSNLLYSENFYQQYRSIFMKWIIQINGQVLSTNLSPIKFYTQTQEPLLSISLSDTSL
APPHPPPPGQEAVSQNCAQKLCLDKCNLGPLLCAARFTWSPPTTTPPPADAAVVPVPSVP
QVSARCSCYLVSGGGFGRVSRCALSVFSVSIAVFTSNRKIYSCLKMSGLVRPLKGSDPTV
TPHPTDLSTPQTRFSFLLKSPWSFCSGPQARTILMQSSLPQAQLASIWNLSDIDQDGKLT
AEEFILAMHLIDVAMAGQPLPPVLPAEYIPPSFRGVSALSSASVDQRLPEEPVLEDEQQL
EKKLPVTFEDKKRENFERGNLELEKRRQALLEQQRKEQERLAQLERAEQERKERERQEQE
RKRQLELEKQLEKQRELERQREEERRKEIERREAAKRELERQRQLEWERNRRQELLNQRN
KEQEDIVVLKAKKKTLEFELEALNDKKHQLEGKLQDIRCRLATQRQEIESTNKSRELRIA
EITHLQQQLQEAQQMLGRLIPEKQILNDQLKQVQQNSLHKTGDSLLTLKRALEAKELARQ
QLRDQLDEVEKETRSKLQEIDIFNNQLKELREIHNKQQLQKQKSIEAERLKQKEQERRII
ELEKQKEEAQRRTQERAGQGPEHGLQDDEHQRPRRPHEEQRLRREESARRKDSEDREKGP
LTISAQENVKVVYYRALYPFESRSHDEISIQPGDIVMVDESQTGEPGWLGGELKGKTGWF
PANYAEKIPENEVPAPAKPVTDLTSTPAPKLEVRETPAPPAVTAAEPSATPNNWADFSST
RVSRGWKIRQRSAFTPATATGSSPSPVLGQGEKVEGLQAQALYPWRAKKDNHLNFNKNDV
ITVLEQQDMWWFGEVQGQKGWFPKSYVKLISGPTRKAASPAPLKRVASPAAKPALSGEEF
VAMYTYESAEQGDLTFQQGDVILVTKKDGDWWTGTVGDKSGVFPSNYVRLKDAEGAGTAG
KAGSLGKKPEIAQVIASYTATGPEQLTLAPGQLILIRKKNPGGWWEGELQARGKKRQIGW
FPANYVKLLSPGTSKVTPTEPPMCQVIGMYDYTAQNDDELAFSKGQIINVLSKEDPDWWK
GEVGGHVGLFPSNYVKLTTDTDPSQQCKLESPQRDPLSHITAQRDDGRCSLDHPFNKINK
EITPLLFWFCKKTHYQGMLHVLLKMFQMSVNLRLAQCDQLTGRAGSLREKRRGGQCVQRL
NRSVVRVCVFQMYLYFHGYECKEEGLKLSPAGSQEAWKGKEWRFWGEVPCKGPGRAASSV
SVPLLRSTLPASPRRSRGSSSPGLGIGRGEAGVQPAPQGMKEPGGDDRVRWGTQAHLLRF
GKSQGQLVFNSVTNCLGPRKFLHSGKLYKAKSNKELYGFLFNDFLLLTQIVKPLGSSGTD
KVFSPKSNLQYKMYKTGCGPSSLTVREPEPGRSSWPSGQTAGASRSSPPSVFPSRTAWVQ
KIKAASELYIETEKKKREKAYLVRSQRATGIGRLMVNVVEGIELKPCRSHAEGGPWVGAA
SASQSFRALLHAHPSSSASCSVGYRAGAPTRQPRSLFAGGEDDFLGRTEIRVADIKRDQG
SKGPVTKCLLLHEVPTGEIVVRLDLQLFDE
Download sequence
Identical sequences G1PYE2
ENSMLUP00000016474 ENSMLUP00000016474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]