SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000016537 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000016537
Domain Number 1 Region: 120-398
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.43e-75
Family Protein kinases, catalytic subunit 0.00000000014
Further Details:      
 
Domain Number 2 Region: 387-444
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000841
Family SH3-domain 0.0017
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000016537
Domain Number - Region: 7-69
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0321
Family SAM (sterile alpha motif) domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000016537   Gene: ENSMLUG00000017526   Transcript: ENSMLUT00000025319
Sequence length 708
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429872:703136:719246:1 gene:ENSMLUG00000017526 transcript:ENSMLUT00000025319 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPEEGTGWLLELLSEVQLQQYFLRLRDDLNVTRLSHFEYVKNEDLEKIGMGRPGQRRLW
EAVKRRKAMCKRKSWMSKVFSGKRLEAEFPPHHSQSAFPKTSPTPGGPAGEGPLQSLTCL
IGEKDLRLFEKLGDGSFGVVRRGEWDAPSGKTVSVAVKCLKPDVLSQPEAMDDFIREVNA
MHSLDHRNLIRLYGVVLTPPMKMVTELAPLGSLLDRLRKHQGHFLLGTLSRYAVQVAEGM
GYLESKRFIHRDLAARNLLLATRDLVKIGDFGLMRALPQNDDHYVMQEHRKVPFAWCAPE
SLKTRTFSHASDTWMFGVTLWEMFTYGQEPWIGLNGSQILHKIDKEGERLPRPEDCPQDI
YNVMVQCWAHKPEDRPTFVALRDFLLEAQPTDMRALQDFEEPDKLHIQMNDVITVIEGRA
ENYWWRGQNTRTLCVGPFPRNVVTSVAGLSAQDISQPLQNSFIHTGHGDSDPRHCWGFPD
KIDELYLGNPMDPPDLLSVELSTSRPTQHLGRVKREPPPRPPQPAIFTKKPTYDPVSEDQ
DPLSSDFKRPGVRKPGLPRGLWLTKPSARVSGTKTGRSGGGAEVTLIDFGEEPVVPSPRP
YTPSLAQLAMDACSLLDKTPPQSPTRALPRPLHPTPVVDWDARPLPPPPAYDDVAQDEDD
FEVCSINSTLVGAGVSPGASQGETNYGFVLSRRGLFASSGGQPVLLTP
Download sequence
Identical sequences G1PYK5
ENSMLUP00000016537

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]