SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000018099 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMLUP00000018099
Domain Number - Region: 57-105,292-329
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0443
Family Spectrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000018099   Gene: ENSMLUG00000029143   Transcript: ENSMLUT00000028319
Sequence length 333
Comment pep:novel scaffold:Myoluc2.0:AAPE02070408:2330:4821:-1 gene:ENSMLUG00000029143 transcript:ENSMLUT00000028319 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FSFHLEDEEFVVAIEYLNDPFNKEKLQHFLSDESWERFVAAGKVSRDVADALYADLRQQE
TLMAEEDKDMPSIEQEFRESFMKQFPQEKQFIEECIGKLYALADEVDKVHRDCTISKVAA
SSTSIVSGILTILGLSLAPVTLGASLVLSATGMGLGAAAAVTGVTADIVEDSKNKSAKAK
ARCLVSKGSDKGNVVQELLLGSAPKIVSLARKCSISVIDIVKNARAFNLAKSNPVLAAEA
RSFMRAGTMSAPSDKQVQKAFGGTALAMNKEARIVGATTAGVFILMDVIELVIESVHLHK
GAKAQSAEELRQLAQELERRWEERTHFLESLPN
Download sequence
Identical sequences G1Q316
ENSMLUP00000018099 ENSMLUP00000018099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]