SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000018203 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000018203
Domain Number 1 Region: 10-57
Classification Level Classification E-value
Superfamily Ribosomal protein L39e 1.83e-21
Family Ribosomal protein L39e 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000018203   Gene: ENSMLUG00000027638   Transcript: ENSMLUT00000031011
Sequence length 58
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430171:812028:812204:1 gene:ENSMLUG00000027638 transcript:ENSMLUT00000031011 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RVCLSLTMSSHKTFRIKRFLAKKQKQNRPIPQWIRMKTGNKIRYNSKRRHWRRTKLGL
Download sequence
Identical sequences G1Q3C0
ENSMLUP00000018203 ENSMLUP00000018203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]