SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000018431 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMLUP00000018431
Domain Number - Region: 29-106
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00525
Family Spectrin repeat 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000018431   Gene: ENSMLUG00000023302   Transcript: ENSMLUT00000026898
Sequence length 131
Comment pep:novel scaffold:Myoluc2.0:GL429859:2162100:2162495:-1 gene:ENSMLUG00000023302 transcript:ENSMLUT00000026898 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKDVLGAGLHFDELNKLRVLDPEVTQQTIELKEECKDFVDKIGQFQKIVAGLLELVDQL
AKEAENEKMKATGACNLLKSIIKQREAQQRQLQALIAEKKMQLERYRVEYEALCKVEAEQ
NEFIDQFIFPK
Download sequence
Identical sequences G1Q3Z8
ENSMLUP00000018431 ENSMLUP00000018431

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]