SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000018794 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMLUP00000018794
Domain Number - Region: 8-100
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00118
Family Spectrin repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000018794   Gene: ENSMLUG00000023492   Transcript: ENSMLUT00000031296
Sequence length 374
Comment pep:novel scaffold:Myoluc2.0:GL430049:1586782:1598113:1 gene:ENSMLUG00000023492 transcript:ENSMLUT00000031296 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CSSVLLSLADLDVFIKNSEGSLLKKVEKGDSNGLVEIMQHLMALKERQSSTDEMFEPLKQ
TIELLKTYEQELPETVFKLLEELPEKWNNIKKLAITVRQHVAPLQASEVALLRQRCTAFE
AEQQQFWERFHREAPFRFDSTDPHQSLDARHMELQEMESAMASISDSASLFEVNVPDYRQ
LRQCRREICQLKELWDTVGMVTSNIHAWEATPWKSINVEAMDLECKRFARYLRNLDKEVR
AWDAFTGLESMVLNTLTSLRAVAELQNPAIRERHWRQLMQATGVSFTMGEGTTLAQLLQL
QLHRFEDEVQGIVDRAVKEMGMEKTLKELQATWAGMEFQYELHLRTSVPLLRSDEDLIEV
LEDNQVQLQNLMMS
Download sequence
Identical sequences G1Q511
ENSMLUP00000018794 ENSMLUP00000018794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]