SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000019372 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000019372
Domain Number 1 Region: 3-49
Classification Level Classification E-value
Superfamily Ribosomal protein L39e 1.44e-17
Family Ribosomal protein L39e 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000019372   Gene: ENSMLUG00000025012   Transcript: ENSMLUT00000025914
Sequence length 50
Comment pep:novel scaffold:Myoluc2.0:GL429767:11539105:11539257:1 gene:ENSMLUG00000025012 transcript:ENSMLUT00000025914 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSHKTFRIKRFLAKKQKQNRPIPQWIWMKTGNKIKYSSKRHWRRTKLGL
Download sequence
Identical sequences G1Q6N9
ENSMLUP00000019372 ENSMLUP00000019372

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]