SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000019391 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000019391
Domain Number 1 Region: 290-317,347-401
Classification Level Classification E-value
Superfamily SH3-domain 3.05e-20
Family SH3-domain 0.00067
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000019391
Domain Number - Region: 47-104
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.00288
Family SNARE fusion complex 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000019391   Gene: ENSMLUG00000028840   Transcript: ENSMLUT00000029415
Sequence length 407
Comment pep:novel scaffold:Myoluc2.0:GL429778:15573343:15574933:-1 gene:ENSMLUG00000028840 transcript:ENSMLUT00000029415 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKLQMLLKEEIPSGKRALTESYQNLTRVADYCENTYIQATDKRKALEETKAYTTQSLAS
VAYQINALANNVLQLLDTQASQLRRMESSINHISQTVDIHKEKVAQREIGILTTNKKTSR
THKIIAPANMEHPVRHIQKRIDYTVLDDVGHGVKHGNNLNSPTQKPPSPPTSARGTMGRN
RPYKTLEPVKPPTVPNDYMTSPARLGSQHSPGRTASLTQRPRTRSGSSEGSGSRENSGSS
SIGIPIAMPTPSPPTIGSAAPGRTPSVTAQFSAQPPGNGGPLYSQNSIADSQTPPPPLPP
DNIPMFDDSPPPPPPPPVDYKDEEAALVHYNDPYADGDPAWAPKNYIEKVVAIYDYTKDK
DDELSFMRVQSFYVIKKNDDGWYEGVYNRVTGLFPGNYVESIMHYTD
Download sequence
Identical sequences G1Q6Q8
ENSMLUP00000019391 ENSMLUP00000019391

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]