SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000019602 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMLUP00000019602
Domain Number - Region: 17-67
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00216
Family Spectrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000019602   Gene: ENSMLUG00000027449   Transcript: ENSMLUT00000028688
Sequence length 109
Comment pep:novel scaffold:Myoluc2.0:AAPE02066390:1077:4989:-1 gene:ENSMLUG00000027449 transcript:ENSMLUT00000028688 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LIIIGSFFMLNLVLGVLSGEFAKERERVENRRAFLKLKLRRQQQIERELNGYMEWISKAE
EVILAEDETDGEQRHPFDALRRATIKKSKTDLLNPEEAEDQLADIASVG
Download sequence
Identical sequences G1Q7B9
ENSMLUP00000019602 ENSMLUP00000019602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]