SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000019711 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000019711
Domain Number 1 Region: 48-134
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000863
Family Spectrin repeat 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000019711   Gene: ENSMLUG00000027084   Transcript: ENSMLUT00000027818
Sequence length 138
Comment pep:novel scaffold:Myoluc2.0:GL429787:9771336:9777276:-1 gene:ENSMLUG00000027084 transcript:ENSMLUT00000027818 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ASIPLKELEQFNSDIQKLLEPLEAEIQQGVNLKEEDFNKDMSEDNEGTVKELLQRGDNLQ
QRITDERKREEIKIKQQLLQTKHNALKDLRSQRRKKALEISHQWYQYKRQADDLLKCLDD
IEKKLASLPEPRDERKIK
Download sequence
Identical sequences G1Q7M8
ENSMLUP00000019711 ENSMLUP00000019711

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]