SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000020075 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000020075
Domain Number 1 Region: 2-69
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000624
Family Spectrin repeat 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000020075   Gene: ENSMLUG00000024582   Transcript: ENSMLUT00000028662
Sequence length 70
Comment pep:novel scaffold:Myoluc2.0:GL429787:9076622:9076831:-1 gene:ENSMLUG00000024582 transcript:ENSMLUT00000028662 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ERIQNQWDEVQEHLQNRRQQLNEMLKDSTQWLEAKEEAEQVLGQVRGKLESWKEGPYTTD
AIQKKIKETK
Download sequence
Identical sequences G1Q8P2
ENSMLUP00000020075 ENSMLUP00000020075

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]