SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000020371 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000020371
Domain Number 1 Region: 102-282
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.96e-36
Family BAR domain 0.0076
Further Details:      
 
Domain Number 2 Region: 2-64
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 7.98e-19
Family DBL homology domain (DH-domain) 0.0014
Further Details:      
 
Domain Number 3 Region: 436-500
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000171
Family SH3-domain 0.00037
Further Details:      
 
Domain Number 4 Region: 331-413
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000683
Family SH3-domain 0.0000882
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000020371   Gene: ENSMLUG00000025094   Transcript: ENSMLUT00000025034
Sequence length 502
Comment pep:novel scaffold:Myoluc2.0:GL429949:2441701:2471579:-1 gene:ENSMLUG00000025094 transcript:ENSMLUT00000025034 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSLLIKPIQRVTKYPLLLCELRNSTPPSHPDFRALEDACAAVKDINVNINELKRRKDLV
LKYKKNDEDESLKDKLSKLNIHSISKKSKRVTNYLKILTRGESQVKDNTFNREEKLFRSL
EKTVRHCVKNISFCLQHIQNTMCGRAHTVRLKLRGQCAEVSCSVLNMRDTYLHIFIGQNL
KKLVLTPLSALLSLFPGPQKLIQKRYDKLLDYNSYLQRAAGEESDLAKKEYEALNAQLVE
ELQVFNQAARKILLNCLCSFITLLRDLTLVRQQLYSTVVPYHYISEMQNRVLEEVQNLNF
IKDNSATFIERKLSFEKKKPVQVPPEVPRQTDTHRSKLLSTYTTEELYQAKRKCNATQEY
DINLLEGELVAVMEQKDPLGSTSRWLVDTGIIKGYVYSSFLKPYNPAKAQKKVIENLTGG
CSGSWQIPPPPAPACLSFFFFNFPAIFYAVHAFEARSNCELSLQEYQRVHILRFCDLSGN
KEWWLAEARGQKGYVPANYLGK
Download sequence
Identical sequences G1Q9I8
ENSMLUP00000020371 ENSMLUP00000020371

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]