SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000020676 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000020676
Domain Number 1 Region: 17-191
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.83e-50
Family DBL homology domain (DH-domain) 0.0000405
Further Details:      
 
Domain Number 2 Region: 177-323
Classification Level Classification E-value
Superfamily PH domain-like 1.69e-34
Family Pleckstrin-homology domain (PH domain) 0.00058
Further Details:      
 
Domain Number 3 Region: 466-571
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.07e-25
Family DEP domain 0.0025
Further Details:      
 
Domain Number 4 Region: 360-457
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 7.62e-20
Family DEP domain 0.0082
Further Details:      
 
Domain Number 5 Region: 558-641
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000000493
Family PDZ domain 0.023
Further Details:      
 
Domain Number 6 Region: 642-708
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000732
Family PDZ domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000020676   Gene: ENSMLUG00000016835   Transcript: ENSMLUT00000028438
Sequence length 1592
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429857:1403833:1503787:1 gene:ENSMLUG00000016835 transcript:ENSMLUT00000028438 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLQAFLHRIRQNVVDSAEKGLTEDNVKILFSNIEDILEVHKDFLAALEYCLHPEPQSQHE
LGNVFLRFKDKFCVYEEYCSNHEKALRLLVELNKIPTVRAFLLSCMLLGGRKTTDIPLEG
YLLSPIQRICKYPLLLKELAKRTPGKHPDHPAVQSALQAMKTVCSNINETKRQMEKLEAL
EQLQSHIEGWEGSNLTDICTQLLLQGTLLKISAGNIQERAFFLFDNLLVYCKRKSRVTGS
KKSTKRTKSINGSLYIFRGRINTEVMEVENVEDGTADYHSHGYTVTNGWKIHNTAKNKWF
VCMAKTAEEKQKWLDAIIREREQREITTRLGKDRDNLFTYISPASQKLLKSKSHRVIRRI
KSRVRDISNTPPCSMGSEFVAWLLEIGEISKTEEGVNLGQALLENGIIHHVSDKHQFKNE
QVMYRFRYDDGTYKARSELEDIMSKGVRLYCRLHSLYTPVIKETGDYHPKTYKSVLPGSK
LVDWLLAQGDCQTREEAVALGVGLCNNGFMHHVLEKSEFKDESQYFRFHADEEMEGTSSK
NKQLRNDFKLVENILAKRLLILPQEEDYGFDIEEKNKAVVVKSVQRGSLAEMAGLQVGRK
IYSINEDLVFLRPFSEVESILNQSFCSRRPVRLLVATKAKEIVKVPDHPEALCFQIRGAA
PPYVYAVGRGSEAAAAGLCAGQCILKVNGNNVMNDGAPEVLEHFQAFRNRREEALGLYQW
IYHTHEDAQEARASQETPGEDPGGEGAREEDQPDSAFPLLSMGAQLSLHEDSPVVSLNVD
NVHLEHGVVYEYVSTAGIKCHVLEKIVEPRGCFGLTAKILEAFAADDSVFVQNCGRLMAL
SNSIRTMSHFEFRHICDIKLESIGQRIACYQEFAAQLKGRISPPFKQAPLEPHSPCGLDF
CPTNCHINIMEVSYPKTTPSIGRSFSIRFGRKPSLIGLDPEQGHLNPMSYTQHCITTMAA
PSWKCLPAVDGDPQCQSPRDSSFGPANGALGPEDRGLSFLLKQEDREIQDAYLQLFTKLD
VALKEMKQYVTQINRLLSTITEPTSGGSCHPPLAEETSSSPLVNEESEMDRTDHGGIKKV
CFKVSEEDQEDSGHDTMSYRDSYSECNSNRDSVLSYTSVRSNSSYLGSDEMGSGDELPCD
MRIPSDKQDKLHGCLEHLFNQVDSIHALLKGPVMSRAFEETKHFPMDHCLQEFKQKEECT
IRGRSLIQISIQEDPWNLPNSIKTLVDNIQKYVEDGKNQLLLALLKCTDTELQLRRDTIF
CQALVAAVCTFSEQLLAALSYRYNNNGEYEESSRDASRKWLEQVAATGVLLHCQSLLSPA
TVKEERTMLEDLWVTLSELDNVSFSFKQQDENYVANTNVFYHIEGSRQALKVIFYLDSYH
FSKLPSRLESGGSLRLHTVLFTKALENPEGPPPPGSQVVEDLQQEINTQSLEKVQQYYRK
LRAFYLERSNLPTDASTTAVKIDQLIRPINALDELCRLMKSFVHPKPGAAGSLGASLIPV
SSELCYRLGACQIAMCGTGMQRSTLSVSLEQAAILARSHGLLPKCIMQATDIMRKQGPRV
EILAKNLRVKDQMPQGAPRLYRLCQPPVDGDL
Download sequence
Identical sequences G1QAE3
ENSMLUP00000015365 ENSMLUP00000020676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]