SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000021704 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000021704
Domain Number 1 Region: 2-147
Classification Level Classification E-value
Superfamily EF-hand 5.78e-56
Family Calmodulin-like 0.000000941
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000021704   Gene: ENSMLUG00000026205   Transcript: ENSMLUT00000026827
Sequence length 149
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429916:2481750:2482199:1 gene:ENSMLUG00000026205 transcript:ENSMLUT00000026827 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG
NGTIDFPEFFTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDE
EVDEMIREADNDGDGQVIYEEFVQMMTAK
Download sequence
Identical sequences G1QDC1
ENSMLUP00000021704 ENSMLUP00000021704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]