SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000021903 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000021903
Domain Number 1 Region: 3-50
Classification Level Classification E-value
Superfamily Ribosomal protein L39e 1.7e-18
Family Ribosomal protein L39e 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000021903   Gene: ENSMLUG00000015029   Transcript: ENSMLUT00000015027
Sequence length 51
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429808:1640674:1640826:1 gene:ENSMLUG00000015029 transcript:ENSMLUT00000015027 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSHKIFRIRRFLAKKQKQNWPIPQWIQMKTGNKISYNSKRRHWRRTKLGL
Download sequence
Identical sequences G1QDX0
ENSMLUP00000021903 ENSMLUP00000021903

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]