SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000021967 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000021967
Domain Number 1 Region: 199-354
Classification Level Classification E-value
Superfamily Spectrin repeat 1.99e-22
Family Spectrin repeat 0.0038
Further Details:      
 
Domain Number 2 Region: 23-145
Classification Level Classification E-value
Superfamily Spectrin repeat 4.44e-16
Family Spectrin repeat 0.0033
Further Details:      
 
Domain Number 3 Region: 551-636
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000602
Family Spectrin repeat 0.0093
Further Details:      
 
Domain Number 4 Region: 691-801
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000468
Family Spectrin repeat 0.015
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000021967
Domain Number - Region: 475-589
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0131
Family Spectrin repeat 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000021967   Gene: ENSMLUG00000023701   Transcript: ENSMLUT00000026789
Sequence length 939
Comment pep:novel scaffold:Myoluc2.0:GL430172:185325:228360:1 gene:ENSMLUG00000023701 transcript:ENSMLUT00000026789 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEDGGVDADLPDCNCDVIQLPKLKETLVAVQQLDKNMSSLRTWLAHIESELAKPIVYDS
CNSEEIQKKLQEQQDLQRDIEKHSTGVASVLNLCEVLLHDCDACATDAECDSIQQATRNL
DRRWRNICAMSMERRLKIEETWQLWQKFLDDYSRFEDWLKTSERTAAFPSSSGVLYTVAK
EELKKFEAFQRQVHESLTQLELINKQYRRLARENRTDSACSLKQMVHEGNQRWDNLQKRV
SSILRRLKHFIGQREEFETARDSILVWLTEMDLQLTNIEHFSECDVHAKIKQLKAFQQEI
SLNHNKIEQIVAQGEQLIEKSEPLDAAVIEEELDELRRYCQEVFGRVERYHKKLIRLPLP
DDEHDLSDRELELEDSAALSDLRWHDTSADSVLSPQPSSNPSLSLAQPLRSERSGRDTPA
SVDSIPLEWDHDYDLSRDLESAVSRTLPSEDEEGQEDKDFYLRGAVGLSGDPSALESQIR
QLGKALDDSRLRMQQTEDIIRSKTPTGPELDASYRGYMKLLAECSGSIDSVRRLEHQLKE
EEENFPGFVNLNSTEAQTAGVIDRWELIQAQALSKELRMKQNLQKWQQFGSDLNNIWTWL
GATEEELERLRRLELSTDIQSIELQIKKLKLIEKFISAPPLLLLLIHGIHSFNRHLLSTS
EDRQNRGQYEQNAVREAGVTRTIRQVIRNEIMQGLDFHEMSHGLLLMLENIDRRKNEIVP
IDSHLDAEILQDQHKQLTQIRQELLESQLKVASLQDMSCQLLVNAEGTDCLEAKEKVHVI
GNRLKLLLKEVGRHLKELEKLLDMSSSQQDLSSWSSADELDTSGSLSPTSGRSTPNRQRT
PRGKCSLSQPGPSVNSPHSRSIKGGSDSSLSEPQPARSGRGFLYRVLRAALPLQLLLLLL
IGLACLVPMSEEDYSCALSNNFARSFHPMLRYTNGPPPL
Download sequence
Identical sequences G1QE34
ENSMLUP00000021967 ENSMLUP00000021967

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]