SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000022476 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000022476
Domain Number 1 Region: 313-574
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.63e-81
Family Protein kinases, catalytic subunit 0.0000000192
Further Details:      
 
Domain Number 2 Region: 170-301
Classification Level Classification E-value
Superfamily SH2 domain 2.7e-29
Family SH2 domain 0.0000267
Further Details:      
 
Domain Number 3 Region: 4-101
Classification Level Classification E-value
Superfamily PH domain-like 3.29e-29
Family Pleckstrin-homology domain (PH domain) 0.00023
Further Details:      
 
Domain Number 4 Region: 118-196
Classification Level Classification E-value
Superfamily SH3-domain 2.72e-17
Family SH3-domain 0.0000243
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000022476   Gene: ENSMLUG00000023677   Transcript: ENSMLUT00000027821
Sequence length 586
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430116:553191:590334:-1 gene:ENSMLUG00000023677 transcript:ENSMLUT00000027821 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QKKYRKGFIDVSKIKCVEVVKNDDGVIPCQNKYPFQVVHDANTLYIFAPSAQSRDQWVKK
LKEEIKNNNNIMIKYHPKFWADGSYQCCRQTEKLAPGCEKYNLFESSIRKVLPPAPETKK
RRPPPPIPPEEEDNSEEIVVAMYDFQATEAHDLRLERGQEYIILEKNDVHWWRARDKYGS
EGYIPSNYVTGKKSNNLDQYEWYCRNMNRSKAELLLRSEDKEGGFMVRDSSQPGMYTVSL
YTKFGGEGSSGFRHYHIKETTTSPKKYYLAEKHAFGSIPEIIEYHRHNAAGLVTRLRYPV
SAKEKKAPTTAGFSYEKWEINPSELTFMRELGSGLFGVVRLGKWRAQYKVAIKAIREGAM
CEEDFIEEAKVMMKLTHPKLVQLYGVCTQQKPIYIVTEFMERGCLLNFLRQRQGHFSRDV
LLSMCQDVCEGMEYLERNSFIHRDLAARNCLVNEAGVVKVSDFGMARYVLDDQYTSSSGA
KFPVKWCPPEVFNYSRFSSKSDVWSFGVLMWEVFTEGRMPFEKNTNYEVVTMVTRGHRLY
RPKLASKYVYDVMLRCWQEKPEGRPSFEDLLRTIDELVECEETFGR
Download sequence
Identical sequences G1QFJ3
ENSMLUP00000022476 ENSMLUP00000022476

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]