SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000022571 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000022571
Domain Number 1 Region: 18-110
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000555
Family RING finger domain, C3HC4 0.014
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000022571
Domain Number - Region: 182-239
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0388
Family Spectrin repeat 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000022571   Gene: ENSMLUG00000027843   Transcript: ENSMLUT00000026460
Sequence length 320
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430052:708140:722781:1 gene:ENSMLUG00000027843 transcript:ENSMLUT00000026460 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNFAVGFKPLLGDAHSMDNLEKQLICPICLEMFSKPVVILPCQHNLCKCANDVFQASNPL
WQSRGSTTVSSGGRFRCPSCRHEVVLDRHGVYGLQRNLLVENIIDIYKQESSRRPSHHHT
TRFHIKCNLKLYCLWNSCPDGALMVGQPWLQWEGYSARPGPPALSADLCVWQSELSDGIA
MLVAGNDRVQAVITQMEEVCQTIEDNSRRQKQLLNQRFETLCAVLEERKGELLQALAREQ
EQKLQRVRGLIRQYGDHLEASSKLVESAIQSMEEPQMALYLQQAKELINKVGAMSKVELA
GRPEPGYESMEQFSVSVEHV
Download sequence
Identical sequences G1QFT8
ENSMLUP00000022571 ENSMLUP00000022571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]