SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000022668 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMLUP00000022668
Domain Number - Region: 9-102
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0216
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number - Region: 147-214
Classification Level Classification E-value
Superfamily occludin/ELL-like 0.0314
Family Occludin/ELL domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000022668   Gene: ENSMLUG00000023453   Transcript: ENSMLUT00000026648
Sequence length 289
Comment pep:novel scaffold:Myoluc2.0:AAPE02064746:250:10866:1 gene:ENSMLUG00000023453 transcript:ENSMLUT00000026648 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EHLLRFVIDSLNELQEFIKETDGGLQRELSEGDHDGLIDIMGHLLAVRSRQRATDELFEP
LKETITLLETYGQKMPEQVYIQLEELPERWETTKKIAATVRHEVSPLQNAEVTLIRKKCI
LFDGKQAEFRERFKLYAPFGFHAENPYTVLDKANQELEALEEEMLQMQESTRLFEVVLPE
YKPMKQCRREIKLLKGLWDVIAYVKRSIDNWTKTQWRQINVEQMDVELRRFAKEIWSLDK
EVRVWDAYTGLEGMVKDMAASLRAVRELQSPALRDRHWHQLMKAIGVSF
Download sequence
Identical sequences G1QG35
ENSMLUP00000022668 ENSMLUP00000022668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]