SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000000796 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000000796
Domain Number 1 Region: 31-261
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.53e-87
Family Calponin-homology domain, CH-domain 0.0000192
Further Details:      
 
Domain Number 2 Region: 279-401
Classification Level Classification E-value
Superfamily Spectrin repeat 7.81e-33
Family Spectrin repeat 0.000000765
Further Details:      
 
Domain Number 3 Region: 515-636
Classification Level Classification E-value
Superfamily Spectrin repeat 1.96e-31
Family Spectrin repeat 0.00000411
Further Details:      
 
Domain Number 4 Region: 396-511
Classification Level Classification E-value
Superfamily Spectrin repeat 5.23e-24
Family Spectrin repeat 0.00000183
Further Details:      
 
Domain Number 5 Region: 744-871
Classification Level Classification E-value
Superfamily EF-hand 2.41e-22
Family Calmodulin-like 0.056
Further Details:      
 
Domain Number 6 Region: 640-751
Classification Level Classification E-value
Superfamily Spectrin repeat 5.33e-19
Family Spectrin repeat 0.00000378
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000000796   Gene: ENSMLUG00000000861   Transcript: ENSMLUT00000000870
Sequence length 899
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430140:757524:770651:1 gene:ENSMLUG00000000861 transcript:ENSMLUT00000000870 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EMMVMQPEGLGAGEGPFAGGGGEYMEQEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKA
GTQIENIEEDFRNGLKLMLLLEVISGERLSRPDKGKMRFHKIANVNKALDFIASKGVRLV
SIGAEEIVDGNLKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYRNVNVQN
FHTSWKDGLALCALIHRHRPDLIDYAKLRKDDPIGNLNTAFEVAEKYLDIPKMLDAEDIV
NTPKPDEKAIMTYVSCFYHAFAGAEQAETAANRICKVLAVNQENERLMQEYEKLASELLE
WIRRTIPWLENRVGEHSMSAMQRKLEDFRDYRRLHKPPRVQEKCQLEINFNTLQTKLRLS
HRPAFMPSEGKLVSDIANAWRGLEQVEKGYEDWLLSEIRRLQRLQHLAEKFQQKASLHEA
WTRGKEEMLTQRDYESASLQEVRALIRRHEAFESDLAAHQDRVEHIAALAQELNELDYHE
AASVNSRCQAICDQWDNLGTLTQKRRDALERMEKLLETIDQLQLEFARRAAPFNNWLDGA
VEDLQDVWLVHSVEETQSLLTAHEQFKATLPEADRERGAILGIQGEIQKICQTYGLRPSL
TNPYLTLSAQDINTKWDTVRKLVPSRDQMLQEELARQQVNERLRRQFAAQANAIGPWIQG
KMEEVGRLAVGMAGSLEEQMAGLRQQEQIIINYKNNVDRLEGDHQLLQESLVFDNKHTVY
GMEYLSVGWEQLLTTIARTINEVENQVLTRDAKGLSQDQLNEFRASFNHFDRKRNGMMEP
DDFRACLISMGYDLGEVEFARIMNMVDPNAAGVVTFQAFIDFMTRETAETDTAEQVVASF
KILAGDKNYITPEELRRELPAEQAEYCIRRMTPYKGPGVPAGALDYMAFSSALYGESDL
Download sequence
Identical sequences G1NUA9
ENSMLUP00000000796 ENSMLUP00000000796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]