SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000001113 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000001113
Domain Number 1 Region: 638-893
Classification Level Classification E-value
Superfamily YWTD domain 3.79e-56
Family YWTD domain 0.00000581
Further Details:      
 
Domain Number 2 Region: 26-286
Classification Level Classification E-value
Superfamily YWTD domain 2.49e-55
Family YWTD domain 0.00000166
Further Details:      
 
Domain Number 3 Region: 337-567
Classification Level Classification E-value
Superfamily YWTD domain 3.14e-51
Family YWTD domain 0.00000321
Further Details:      
 
Domain Number 4 Region: 940-1199
Classification Level Classification E-value
Superfamily YWTD domain 7.32e-39
Family YWTD domain 0.0000653
Further Details:      
 
Domain Number 5 Region: 1327-1365
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000249
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 6 Region: 1289-1324
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000903
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 7 Region: 593-639
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000198
Family EGF-type module 0.0091
Further Details:      
 
Domain Number 8 Region: 896-943
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000199
Family EGF-type module 0.016
Further Details:      
 
Domain Number 9 Region: 1250-1288
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000445
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 10 Region: 291-334
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000649
Family EGF-type module 0.011
Further Details:      
 
Domain Number 11 Region: 1207-1259
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000887
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000001113   Gene: ENSMLUG00000001206   Transcript: ENSMLUT00000001215
Sequence length 1607
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430182:132356:181400:-1 gene:ENSMLUG00000001206 transcript:ENSMLUT00000001215 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IAPAPGCVPWPSQWSSRVASVPTASPLLLFANRRDVRLVDAGGVKLESTVVVSGLEDAAA
VDFQFSKGTVYWTDVSEEAIKQTYLNQTGAAVQNVVISGLVSPDGLACDWVGKKLYWTDS
ETNRIEVANLNGTSRKVLFWQDLDQPRAIALDPAHGYMYWTDWGETPRIERAGMDGSTRK
VIVDSDIYWPNGLTIDLEEQKLYWADAKLSFIHRANLDGSFRQKVVEGSLTHPFALTLSG
DTLYWTDWQTRSIHACNKRTGEKRKEILRALYSPMDIQVLSPERQPYIHTQCEEDNGGCS
HLCLLSPREPFYTCACPTGVQLQDNGKTCKAGAEEVLLLARRTDLRRISLDTPDFTDIVL
QVDDIRHAIAIDYDPLEGYVYWTDDEVRAIRRAYLDGSGAQTLVNTEINDPDGIAVDWVA
RNLYWTDTGTDRIEVTRLNGTSRKILVSEDLDEPRAIALHPMMGLMYWTDWGENPKIECA
NLDGQERRVLVNTSLGWPNGLALDLQEGKLYWGDAKTDKIEVINVDGTKRRMLLEDKLPH
IFGFTLLGDFIYWTDWQRRSIERVHKVKASRDVIIDQLPDLMGLKAVNVAKVVGTNPCAD
QNGGCSHLCFFTPRATKCGCPIGLELLSDMKTCIVPEAFLVFTSRATIHRISLETNNNDV
AIPLTGVKEASALDFDVSNNHIYWTDVSLKTISRAFLNGSSVEHVIEFGLDYPEGMAVDW
MGKNLYWADTGTNRIEVARLDGQFRQVLVWRDLDNPRSLALDPTKGYIYWTEWGGKPRIV
RAFMDGTNCMTLVDKVGRANDLTIDYADQRLYWTDLDTNMIESSNMLGQERIVIADDLPH
PFGLTQYSDYIYWTDWNLHSIERADKTSGRNRTLIQGHLDFVMDILVFHSSRQDGLNDCV
PGNGQCGQLCLAVPGGHRCSCASHYTLDPSSRNCSPPSTFLLFSQKNAISRMIPDDQHSP
DLILPLHGLRNVKAIDYDPLDKFIYWVDGRQNIKRARDDGTQPFILTTPSPNQSPDRQPH
DLSIDVYSRTLFWTCEATNTINVHRLDGDAMGVVLRGDRDKPRAIVVNAERGYLYFTNMQ
DRTAKIERAALDGTEREVLFTTGLIRPVALVVDNTLGKLFWVDADLKRIESCDLSGANRL
TLEDANIVQPVGLTVLGRHLYWIDRQQQMIERVEKTTGDKRTRVQGRVAHLTGIHAVEDI
SLEEFSAHPCARDNGGCSHICIAKGDGTPRCSCPVHLVLLQNLLTCGEPPTCSPDQFTCA
TGEHRLHPAWRCDGFPECDDQSDEEGCPVCSDAQFPCARGQCVDLRLRCDGEADCQDRSD
EADCDALCLPNQFRCASGQCILIKQQCDSFPDCIDGSDELMCEITKPPLDEGPAHSSAIG
PVIGIILSLFVMGGVYFVCQRVVCQRYTGANGPFPHEYVSGTPHVPLNFIAPGASQHGPF
TGISCGKSMMSSVSLMGGRGGVPLYDRNHVTGASSSSSSSTKATLYPPILNPPPSPATDP
SLYNVDVFYSSNIPAPARPYRPYIIRGIAPPTTPCSTDVCDSDYSASRWKASKYYLDLNS
DSDPYPPPPTPHSQYLSAEDSCPPSPATERSYFHLFPPPPSPCTDSS
Download sequence
Identical sequences G1NV35
ENSMLUP00000001113 ENSMLUP00000001113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]