SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000001212 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000001212
Domain Number 1 Region: 17-282
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.46e-90
Family Calponin-homology domain, CH-domain 0.00000131
Further Details:      
 
Domain Number 2 Region: 297-419
Classification Level Classification E-value
Superfamily Spectrin repeat 9.95e-34
Family Spectrin repeat 0.0000609
Further Details:      
 
Domain Number 3 Region: 2210-2329
Classification Level Classification E-value
Superfamily PH domain-like 1.13e-33
Family Pleckstrin-homology domain (PH domain) 0.0000019
Further Details:      
 
Domain Number 4 Region: 904-1059
Classification Level Classification E-value
Superfamily Spectrin repeat 3.27e-28
Family Spectrin repeat 0.0027
Further Details:      
 
Domain Number 5 Region: 1011-1165
Classification Level Classification E-value
Superfamily Spectrin repeat 1.8e-26
Family Spectrin repeat 0.0000352
Further Details:      
 
Domain Number 6 Region: 1852-2007
Classification Level Classification E-value
Superfamily Spectrin repeat 9.12e-26
Family Spectrin repeat 0.0023
Further Details:      
 
Domain Number 7 Region: 1223-1376
Classification Level Classification E-value
Superfamily Spectrin repeat 1.01e-25
Family Spectrin repeat 0.00065
Further Details:      
 
Domain Number 8 Region: 694-810
Classification Level Classification E-value
Superfamily Spectrin repeat 7.55e-25
Family Spectrin repeat 0.0017
Further Details:      
 
Domain Number 9 Region: 1746-1900
Classification Level Classification E-value
Superfamily Spectrin repeat 1.1e-23
Family Spectrin repeat 0.0028
Further Details:      
 
Domain Number 10 Region: 479-629
Classification Level Classification E-value
Superfamily Spectrin repeat 9.17e-23
Family Spectrin repeat 0.0013
Further Details:      
 
Domain Number 11 Region: 1559-1689
Classification Level Classification E-value
Superfamily Spectrin repeat 1.92e-22
Family Spectrin repeat 0.0012
Further Details:      
 
Domain Number 12 Region: 817-944
Classification Level Classification E-value
Superfamily Spectrin repeat 5.63e-21
Family Spectrin repeat 0.003
Further Details:      
 
Domain Number 13 Region: 1479-1591
Classification Level Classification E-value
Superfamily Spectrin repeat 1.96e-20
Family Spectrin repeat 0.00033
Further Details:      
 
Domain Number 14 Region: 1379-1490
Classification Level Classification E-value
Superfamily Spectrin repeat 2.62e-19
Family Spectrin repeat 0.00088
Further Details:      
 
Domain Number 15 Region: 2012-2073
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000173
Family Spectrin repeat 0.0027
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000001212
Domain Number - Region: 650-690
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00288
Family Spectrin repeat 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000001212   Gene: ENSMLUG00000001300   Transcript: ENSMLUT00000001320
Sequence length 2387
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430140:855521:884021:-1 gene:ENSMLUG00000001300 transcript:ENSMLUT00000001320 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSTLSPTDFDSLEIQGQYSDINNRWDLPDSDWDNDSSSARLFERSRIKALADEREAVQK
KTFTKWVNSHLARVTCRVGDLYSDLRDGRNLLRLLEVLSGETLPKPTKGRMRIHCLENVD
KALQFLKEQKVHLENMGSHDIVDGNHRLTLGLVWTIILRFQIQDISVETEDNKEKKSAKD
ALLLWCQMKTAGYPNVNVHNFTTSWRDGLAFNAIVHKHRPDLLDFESLKKCNAHYNLQNA
FNLAEKELGLTKLLDPEDVNVDQPDEKSIITYVATYYHYFSKMKALAVEGKRIGKVLDHA
MEAERLVEKYESLASELLQWIEQTIVTLNDRQLANSLSGVQNQLQSFNSYRTVEKPPKFT
EKGNLEVLLFTIQSKLRANNQKVYTPREGRLISDINKAWERLEKAEHERELALRTELIRQ
EKLEQLAARFDRKAAMRETWLSENQRLVSQDNFGLELAAVEAAVRKHEAIETDIVAYSGR
VQAVDAVAAELAAERYHDIKRISARQHNVARLWDFLRQMVAARRERLLVNLELQKVFQDL
LYLMDWMDEMKGRLQSQDLGKHLAGVEDLLQLHELVEADIAAQAERVRAVSASALRFCDP
GKVQTVDPQLVSERVATLEQTFEALCKFAAPGGPVWRSPPLWRFLWEAGEEAWVREQQHL
LASAETGRDLTGVLRLLNKHTALRGEMSGRLGPLKLTLEQGQQLVAEGHPGAGQAAARAA
ELQAQWERLEALAEERAQRLAQAASLYQFQADANDMEAWLVDALRLVSSPELGHDEFSTQ
ALARQHRALEEEIRGHRPTLDALREQAAALPLALSRTPEVQGRVPTLERHYEELQARAGE
RARALEAALARYTMLSEAGACGLWVEEKEQWLNGLTLPERLEDLEVVQQRFETLEPEMNA
LAARITAVNTIAEQLLQANPAGKDSIVNTQKQLNHRWQQFRSLADGKKAALTSALSIQNY
HLECTETQAWMREKTKVIESTQGLGNDLAGVLALQRKLAGTERDLEAIATRVGELTREAN
ALAAGHPAQSSAIHARLGEVQAGWEDLRATMRRREESLGEARRLQDFLRSLDDFQAWLGR
TQTAVASEEGPATLPEAEALLAQHAALRGEVERAQSEYSRLRALGEEVTRDQADPQCLFL
RQRLEALGTGWEELGRMWESRQGCLAQAHGFQGFLRDARQAEGVLSSQEYVLSHTEMPGT
LQAADATIKKLEDFVSTMDANGERIRGLLEAGRQLVSEGNIHAEKIREKADSIERRHRKN
QEAVQQLLGRLRDNREQQHFLQDCHELKLWIDEKMLTAQDVSYDEARNLHTKWQKHQAFM
AELAANKDWLDKVDKEGRELSLEKPELKALVSEKLEDLHRRWDELETTTQAKARSLFDAN
RAELFAQSCSALESWLLSLQAQLHSDDYGKDLTSVNILLKKQQMLEREMAVREKEVEAIQ
AQAKALAQEDQGAGEVERTSRAVEEKFRALCQPMRERCQRLQASREQHQFHRDVEDEILW
VTERLPMASSREHGKDLPSVQLLMKKNQTLQKEIQGHEPRIADLRERQRALGAAAAGPEL
AELQEMWKRLSHELELRGKRLEEALRAQQFYRDAAEAEAWMGEQELHMMGQEKAKDELSA
QAEVKKHQVLEQALADYAQTIHQLAASSQDMIDHDHPESTRISIRQAQVDKLYAGLKELA
GERRERLQEHLRLCQLRRELDDLEQWIQEREVVAASHELGQDYEHVTMLRDKFREFSRDT
STIGQERVDSANALANGLIDGGHAARATVAEWKDSLNEAWADLLELLDTRGQVLAAAYEL
QRFLHGARQALARVQQKQQQLPDGTGRDLNAAEALQRRHCAFEHDIQALSAQVQQVQDDG
HRLQKAYAGDKAEEIGRHMQAVTEAWAQLQGNSAARRQLLLDTTDKFRFFMAVRELMLWM
DGVNLQMDAQERPRDVSSADMVIKNHQGIKAEIEARADRFSSCIDMGQGLLARSHYAAEE
ISEKLSQLQARRQETADKWQEKMDWLQLVLEVLVFGRDAGMAEAWLCSQEPLVRSAELGC
TVDEVENLIKRHEAFQKSAVAWEERFSALEKLTALEEQEKERKRKREEEERRKQPPAPEP
TASLPGGVLVDGQTAPDASWDGAHPRLPAPTQAASINGVCTDGESPQPLLEQQRLEQGSF
PEGPASGPGDETNGPQGERQTRTQGSAPPVLPQSRSSESARVATLPSRGPELSAQEQMEG
MLCRKQEMEAFGKKAANRSWQNVYCVLRHGSLGFYKDVKAASTGVPYHGEVPVSLARAQG
SVAFDYRKRKHVFKLGLQDGKEYLFQAKDEAEMSSWLRVVNAAIATASSASGEPEEPTVP
SATRGMTRAMTMPPVSPVGAEGPVVLRSKDGREREREKRFSFFKKNK
Download sequence
Identical sequences G1NVC1
ENSMLUP00000001212 ENSMLUP00000001212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]