SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000001213 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000001213
Domain Number 1 Region: 4-133
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.81e-51
Family Calponin-homology domain, CH-domain 0.000000345
Further Details:      
 
Domain Number 2 Region: 205-267
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 1.15e-21
Family EB1 dimerisation domain-like 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000001213   Gene: ENSMLUG00000001328   Transcript: ENSMLUT00000001321
Sequence length 285
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430052:511667:515213:1 gene:ENSMLUG00000001328 transcript:ENSMLUT00000001321 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SWGMAVNVYSTSVTSENLSRHDMLAWVNDSLHLNYTKIEQLCSGAAYCQFMDMLFPGCVH
LRKVKFQAKLEHEYIQNFKVLQAAFKKMGVDKIIPVEKLVKGKFQDNFEFIQWFKKFFDA
NYDGKEYNPLLARQGQDVAPPPNPGDQIFNKSKKLIGTAGNMLGEGVCGAGPARSASWAT
RPPGPAPREKNPPSARNGGHETDAQILELNQQLLDLKLTVDGLEKERDFYFSKLRDIELI
CQEHESENSPVIAGIIGILYATEEGFAPPEDDEIEEHQQEEQDEY
Download sequence
Identical sequences G1NVC2
ENSMLUP00000001213 ENSMLUP00000001213

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]